Identifiers and Description

Gene Model Identifier

SteCoe_34117

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001611802.7487850079102147e-43Subunit of Replication factor
C (RF-C), which acts as a clam
p loader of the proliferating
cell nuclear antigen (PCNA)
Oxytricha TrifallaxContig1144.0.g1182.031092662734811e-42Replication factor C C-termina
l domain

WormBaseWBGene000043392.2273635617957438e-39
Saccharomyces CerevisiaeYBR087W2.4426007377405277e-36Subunit of heteropentameric Re
plication factor C (RF-C); RF-
C is a DNA binding protein and
ATPase that acts as a clamp l
oader of the proliferating cel
l nuclear antigen (PCNA) proce
ssivity factor for DNA polymer
ases delta and epsilon

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34117(Protein)
MSAKLWVDKYRPNTLDELTYHTDLSNLLKRLGESGDIPHLLFYGPSGAGKKTRVLALLHT
IFGANVSKVKCEVRSFKAGTTTAEITVLQSNSHIDMTPSDVGFRDRVVVQQIIKEIGSSK
NPDGRNFKAIILNQADYLSDEAQAALRRTLEKYTATTRLILIANSLCRIIAPIRSRCLGI
RVSAPTENEIKQVLNIIALQENLTLPTILETRIVANCNRNLRRAIMILQSIYIQHSKLPP
DASVPLPEWEKYLKEITTNILEEQSPKSLKIVRGKLYEVLASCIPATTIFIVLTREIMCR
IDPKLKPWVLSESAKYELVMKNGSKPIIHLEAFIARFMSGYKDFMQGIPLS


>SteCoe_34117(CDS)
ATGTCAGCAAAACTATGGGTAGACAAATATCGGCCTAATACTTTAGATGAGCTCACTTAT
CACACAGACCTATCAAATCTTCTAAAACGCTTAGGAGAATCCGGTGATATCCCACACTTG
CTCTTTTATGGTCCCTCAGGAGCTGGAAAAAAAACTAGAGTCTTAGCATTACTACACACA
ATTTTTGGCGCGAATGTATCCAAAGTTAAATGCGAAGTTCGATCATTTAAAGCAGGAACA
ACAACCGCTGAAATCACAGTTCTTCAAAGCAACTCACATATAGACATGACTCCAAGTGAT
GTTGGCTTTAGAGACCGTGTAGTAGTTCAGCAAATAATCAAAGAAATAGGAAGTAGTAAA
AACCCAGATGGACGTAATTTCAAAGCTATTATCTTAAATCAAGCTGATTATCTAAGTGAT
GAAGCCCAAGCAGCATTAAGAAGAACATTAGAAAAATATACAGCGACAACAAGGTTGATT
CTTATAGCAAATAGCTTATGTAGAATAATTGCCCCTATAAGAAGCAGATGTTTAGGTATA
AGAGTTTCAGCTCCAACAGAAAACGAGATAAAACAAGTACTTAATATTATTGCCTTACAA
GAAAATCTAACCCTACCAACAATTTTAGAGACTAGAATAGTGGCGAATTGTAATAGGAAT
TTAAGAAGAGCTATAATGATCCTACAGAGTATATATATACAACATTCAAAATTACCCCCT
GATGCTTCTGTACCATTACCTGAATGGGAAAAGTACTTAAAGGAAATCACAACTAATATA
TTAGAAGAACAATCACCAAAGTCTTTAAAAATTGTTAGAGGGAAATTATATGAAGTCTTA
GCAAGTTGTATTCCGGCAACAACTATTTTTATAGTTCTTACAAGAGAAATCATGTGTCGA
ATAGATCCAAAACTCAAACCCTGGGTGCTTTCTGAGTCAGCGAAATATGAACTTGTTATG
AAAAACGGGTCTAAACCCATAATCCATTTAGAAGCATTTATAGCGAGGTTCATGAGTGGA
TATAAAGACTTTATGCAAGGGATTCCTTTAAGTTAA