Identifiers and Description

Gene Model Identifier

SteCoe_34145

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1124.1.g1111.5007857627073948e-41EF hand

Tetrahymena ThermophilaTTHERM_006898503.6251409191435593e-34Centrin family member; EF-hand
calcium-binding protein; also
called caltractin; GFP-fusion
protein localized to speciali
zed structures in the oral app
aratus and along deep rootlet
WormBaseWBGene000005527.781132241133797e-20
Saccharomyces CerevisiaeYOR257W4.248354255291589e-18Calcium-binding component of t
he spindle pole body (SPB) hal
f-bridge; required for SPB dup
lication in mitosis and meiosi
s II; homolog of mammalian cen
trin; binds multiubiquitinated
proteins and is involved in p
roteasomal protein degradation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34145(Protein)
MAGRGAPAKPAPVSQPKVFNPKQYERPGLTEDEIEEIKEAFDLFDSDGSGTIDPAELKSA
MQSLGFEAKNQTIYQMISDLDKDGSGAIDFDEFLDMMTARMSDKDTKEDINKVFRLFDDD
KTGYVTIKNLRRVAKELGETMTDEELMEMIERADSDGDGQVSQEDFYNIMTKKAFP


>SteCoe_34145(CDS)
ATGGCAGGACGAGGTGCACCCGCAAAACCAGCTCCAGTAAGTCAACCGAAAGTATTCAAT
CCCAAGCAATACGAAAGGCCTGGACTCACTGAAGATGAAATCGAAGAAATTAAGGAAGCT
TTTGACTTATTTGACTCTGATGGATCTGGGACTATTGACCCAGCCGAACTTAAATCAGCC
ATGCAGAGCTTAGGTTTTGAAGCGAAAAATCAGACAATCTATCAGATGATTAGTGATCTT
GACAAAGACGGGTCAGGAGCTATTGATTTTGATGAATTCTTAGACATGATGACAGCTAGA
ATGAGCGATAAGGACACTAAAGAAGACATCAACAAAGTATTTAGACTCTTTGATGATGAC
AAAACTGGCTATGTTACCATTAAAAACTTACGCAGAGTTGCTAAAGAACTTGGAGAAACC
ATGACAGATGAGGAACTCATGGAAATGATTGAAAGAGCTGACTCTGATGGTGATGGACAA
GTAAGCCAAGAAGACTTTTACAACATCATGACCAAGAAAGCCTTCCCTTAA