Identifiers and Description

Gene Model Identifier

SteCoe_34275

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20209.0.g505.900090541597061e-29tRNA synthetases class II (A)

Tetrahymena ThermophilaTTHERM_004731107.095474162284704e-23hypothetical protein
Saccharomyces CerevisiaeYNL040W0.000045399929762484854Putative protein of unknown fu
nction; has strong similarity
to alanyl-tRNA synthases from
Eubacteria; null mutant displa
ys decreased translation rate
and increased readthrough of p
remature stop codons; green fl
uorescent protein (GFP)-fusion
protein localizes to the cyto
plasm; YNL040W is not an essen
tial gene

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34275(Protein)
MERIIAKEYLLDSYKFSTTASIVDLIQVASDIKIKLSNTIFHPQGGGQPNDIGSITQGPI
IFDVKSAETDKTDNNVWHVGKFTSGSEFDRNTEVTVLIDEAKRRLHARLHSGGHLLDIAV
QRLGYPLVPGKGYHFAEGSYVEYVGNIQDKDRAVLDINEECKKIINEAVDSVNAIILSYE
EAQKAFTVPSYLAGESSIRYVKLTPQDNGCPCGGTHVKSVHDIGSVVVTKIQKKGKNLRV
SYKVE


>SteCoe_34275(CDS)
ATGGAAAGGATTATAGCAAAAGAATACCTCCTAGACAGCTATAAGTTCTCCACAACCGCT
TCAATTGTTGATCTTATTCAAGTTGCCTCAGATATCAAAATAAAGCTTTCTAACACCATC
TTCCACCCTCAAGGTGGTGGGCAACCAAATGATATTGGAAGTATAACCCAAGGCCCAATT
ATTTTCGATGTCAAAAGTGCAGAAACAGATAAAACTGATAACAACGTTTGGCATGTTGGG
AAATTTACAAGTGGTTCAGAATTTGATAGAAATACTGAAGTGACTGTTTTAATTGATGAA
GCAAAAAGAAGACTTCATGCAAGACTTCATTCAGGAGGGCATTTATTAGATATTGCCGTA
CAAAGATTAGGTTATCCACTTGTACCTGGAAAAGGTTATCATTTTGCTGAAGGATCATAT
GTTGAGTATGTTGGCAATATTCAAGATAAAGATAGGGCTGTTCTAGATATTAATGAAGAA
TGTAAGAAAATTATTAATGAAGCTGTAGATTCAGTTAATGCAATTATCCTTTCATATGAA
GAAGCACAAAAAGCTTTTACTGTACCAAGTTATCTTGCTGGAGAATCGTCGATAAGATAT
GTTAAACTTACACCTCAGGATAATGGCTGCCCTTGTGGAGGGACACATGTTAAAAGTGTT
CATGATATTGGAAGTGTTGTGGTGACTAAAATACAGAAAAAAGGCAAGAATTTAAGAGTT
TCTTATAAAGTTGAGTAG