Identifiers and Description

Gene Model Identifier

SteCoe_34553

Standard Name

None

Aliases

None

Description

PLK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig13304.0.g940Protein kinase domain

WormBaseWBGene000040444.590938473882946e-48
Saccharomyces CerevisiaeYMR001C2.031092662734811e-42Polo-like kinase; controls tar
geting and activation of Rho1p
at cell division site via Rho
lp guanine nucleotide exchange
factors; regulates Spc72p; al
so functions in adaptation to
DNA damage during meiosis; has
similarity to Xenopus Plx1 an
d S. pombe Plo1p; possible Cdc
28p substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34553(Protein)
MANNDDQPAIIEEKIVRVNGEVAIRQYSKGRFLGKGGFARCYEFASMETRKLTAAKIVPK
ASLTKSRAKQKLMTEIKIHRSLHHPNIVGFEHFFEDSENVYILLELCTNQTMNELLRRRK
RLTELEVQCYLSQVISALSYLHGHRVIHRDLKLGNFFLSDKMEIKIGDFGLATKLEFDGE
KKRTICGTPNYIAPEVLDGKQGHSYEVDIWSLGVVAYTLLVGKPPFETSDVKTTYRRIRM
NAYSFPENVPLSEASKNLVTRILVTDPTKRPTLTEILAHEFFNQGNTIPKTLPPSTLACP
PAASYLRQFMPGITSSASGNVRLTETTPSLPRSTARGVKDDFMNTDRPVKKEEINRQLRS
SASTTGSEIWVKKWVDYSSKYGLGYTLSNGATGVFFNDSTKIILNVAGNKFKYLERKGAE
KQDVCNTYLLTEYPKELQKKITLLQHFRSYLEGDIKQETGDVAQDDNFDENIIYVKKWMR
TRHAIMFRLSNKIVQVNFQDHTEIILSSESRMVTYVNKKGERNTYPLANALESTNLEMTK
RLKYTKEILSSMLSNPKQQEKEHEP


>SteCoe_34553(CDS)
ATGGCTAACAATGATGATCAGCCAGCAATCATTGAAGAAAAGATCGTAAGGGTAAATGGA
GAAGTTGCAATCCGACAGTACTCAAAAGGAAGATTTTTAGGCAAAGGAGGCTTTGCTCGT
TGCTATGAATTTGCTAGTATGGAGACGCGGAAATTGACCGCAGCCAAAATAGTTCCAAAA
GCATCTCTAACCAAAAGCCGTGCCAAGCAAAAACTAATGACAGAAATCAAAATTCACCGA
AGCCTACATCACCCAAATATAGTAGGCTTTGAGCATTTCTTTGAAGACTCAGAAAATGTT
TATATTTTACTTGAACTCTGCACAAACCAAACAATGAACGAGCTTCTCAGGAGAAGAAAG
CGACTAACTGAGCTAGAAGTCCAGTGCTATTTATCACAAGTGATTTCCGCATTATCATAT
CTTCATGGTCACAGAGTTATTCACCGAGACTTAAAACTTGGGAATTTTTTCTTATCAGAC
AAGATGGAAATTAAAATAGGAGACTTCGGACTTGCCACAAAGCTTGAGTTTGACGGGGAA
AAAAAAAGGACAATTTGTGGAACTCCTAATTATATTGCACCAGAAGTTTTGGATGGAAAA
CAAGGGCATTCATATGAAGTGGATATCTGGTCTCTAGGTGTTGTTGCATACACATTACTA
GTTGGAAAGCCCCCATTTGAGACTTCAGATGTTAAAACGACATATAGGAGGATAAGAATG
AATGCATATTCATTCCCTGAAAATGTCCCTTTAAGTGAAGCTAGCAAGAACCTGGTAACA
AGAATACTAGTTACTGATCCAACAAAACGTCCAACTTTGACAGAAATCCTTGCTCATGAA
TTTTTTAACCAGGGAAACACTATTCCTAAAACTCTTCCTCCATCAACTTTGGCTTGTCCT
CCAGCTGCTTCTTATTTAAGACAGTTCATGCCTGGAATTACTTCCTCAGCTTCTGGAAAC
GTAAGACTTACAGAAACAACTCCTAGCCTGCCAAGAAGCACAGCAAGAGGAGTTAAAGAT
GACTTTATGAATACTGATCGCCCTGTAAAAAAAGAAGAAATCAATCGACAACTTCGAAGT
AGTGCGTCAACTACAGGTAGTGAAATTTGGGTTAAAAAGTGGGTCGATTACAGCAGCAAA
TATGGTTTAGGATATACATTGTCTAATGGAGCTACAGGAGTTTTCTTTAATGACTCAACT
AAAATTATTCTCAATGTTGCTGGGAATAAATTTAAATATTTAGAGAGAAAAGGTGCTGAA
AAACAAGACGTATGCAATACTTACCTCCTTACTGAATATCCTAAAGAACTTCAAAAAAAA
ATCACTTTGCTTCAGCATTTTAGAAGCTATTTAGAAGGAGATATTAAACAGGAAACTGGT
GATGTAGCACAAGATGACAACTTTGATGAAAATATTATTTATGTTAAAAAATGGATGAGA
ACAAGGCATGCAATAATGTTCAGACTCAGCAATAAAATTGTCCAAGTAAATTTCCAAGAC
CATACTGAGATAATTTTATCTTCAGAAAGCAGGATGGTAACTTATGTGAATAAGAAGGGA
GAAAGAAATACTTATCCTCTTGCAAATGCCTTAGAAAGTACTAATTTGGAGATGACTAAA
CGGCTTAAATATACTAAGGAAATTTTATCGAGCATGCTTAGTAATCCTAAACAGCAGGAA
AAAGAGCATGAGCCATAA