Identifiers and Description

Gene Model Identifier

SteCoe_34563

Standard Name

None

Aliases

None

Description

PIKK-related kinase

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19156.0.g854.780892883885469e-25Phosphatidylinositol 3- and 4-
kinase

Saccharomyces CerevisiaeYBR136W3.873997628687187e-21Genome integrity checkpoint pr
otein and PI kinase superfamil
y member; Mec1p and Dun1p func
tion in same pathway to regula
te dNTP pools and telomere len
gth; signal transducer require
d for cell cycle arrest and tr
anscriptional responses to dam
aged or unreplicated DNA; faci
litates replication fork progr
ession and regulates P-body fo
rmation under replication stre
ss; promotes interhomolog reco
mbination by phosphorylating H
op1p; associates with shortene
d, dysfunctional telomeres
Tetrahymena ThermophilaTTHERM_010086501.0530617357553812e-20Phosphatidylinositol 3- and 4-
kinase family protein. Sequenc
e similarity to the ATR subfam
ily of the protein kinase PIKK
family (Eisen et al., 2006)."
WormBaseWBGene000002260.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34563(Protein)
MRHGTAYYYHSMPRLLSLFYLLCKFKDTNFDPEKKDMSVIDLKFKEFYKKMIKLADYLPL
FVWADRIGQVLGLINFNMIECANIVVKVLVRLINAHPAQMLWYICPLLTMKKNMENDSRQ
NIVKEVLDKYIEKDPVGLKKNVELIIEFLKLLTYLASVNVKKPEQVFQNILKKKSWVNNL
KGLGLAMPILENFKPLEYDPKKFLYKSNLPAFNPSPSIIAQLSSKFYAFESKEKPKKIEF
VDTNDKSLFFLIKHETHKDVRREHRAIDVFRYINRLFSKDPDCQRLGLRITTFCVHFIGD
NSIIVEWVNKTITLRESILKTMSNEEPANYEYFKYAPPNTYNSEGFKPEDWKRFQERLRP
CFHTYFTNKFTNANEWLKARTLYTRSFAVWSMIGFLIGLGDRHTENILIFDDTCELMFID
FECIFNMGRTLSQPETVLFRLTPEMQSALGLFFEDSEFIKTCAIVLNCLRSYKHLIISNF
ESFITDPLSVTYTNPDISDNDIDPVNTLRIIQARLDGKNNYKSDNTYYNTLQQAKALVKD
ASDSENLRKMWRGWAPYH


>SteCoe_34563(CDS)
ATGAGACATGGAACAGCTTATTATTATCATTCTATGCCACGTTTATTAAGTCTTTTTTAT
TTGTTGTGTAAATTTAAGGATACGAATTTTGATCCTGAAAAAAAAGATATGAGTGTTATT
GATTTGAAATTTAAGGAATTTTATAAGAAAATGATAAAACTTGCTGATTATTTGCCTTTG
TTTGTATGGGCGGATAGGATTGGGCAGGTTTTAGGTTTGATTAATTTTAATATGATTGAA
TGTGCGAATATAGTTGTTAAAGTTCTTGTAAGACTTATAAATGCCCATCCTGCTCAAATG
CTTTGGTATATATGCCCATTACTTACTATGAAAAAGAATATGGAAAATGATTCTAGACAA
AATATTGTTAAAGAAGTTTTAGATAAATATATAGAAAAAGATCCTGTTGGTTTAAAAAAA
AATGTTGAATTAATAATAGAGTTTTTAAAACTTTTGACTTATCTTGCATCAGTTAATGTT
AAAAAACCTGAACAAGTATTTCAGAATATTTTAAAGAAAAAATCATGGGTGAATAATTTG
AAAGGTTTGGGACTTGCTATGCCGATATTAGAAAATTTTAAACCACTTGAGTATGACCCG
AAAAAGTTTTTATATAAAAGCAACCTCCCTGCATTTAACCCTTCACCAAGTATTATAGCG
CAATTAAGCAGTAAGTTTTATGCTTTTGAAAGTAAAGAGAAACCTAAAAAAATTGAGTTT
GTTGATACTAATGACAAGTCTTTGTTCTTCCTTATTAAACATGAAACACATAAAGATGTT
CGAAGAGAACACCGAGCAATTGATGTGTTTAGATATATAAATCGGCTTTTTTCTAAAGAC
CCAGACTGTCAAAGACTTGGCCTAAGAATCACAACTTTTTGTGTGCATTTTATCGGTGAC
AACTCAATAATTGTCGAATGGGTCAACAAAACCATAACTTTAAGAGAATCCATCCTAAAA
ACAATGTCAAATGAAGAACCTGCAAATTATGAATATTTCAAATACGCTCCTCCAAATACT
TACAACAGTGAAGGTTTTAAACCTGAAGACTGGAAAAGATTCCAAGAAAGACTCAGGCCA
TGTTTCCATACATATTTCACTAATAAATTCACTAATGCAAATGAATGGTTAAAAGCTAGA
ACTTTATACACAAGATCTTTTGCTGTATGGAGCATGATAGGATTTTTAATAGGCTTAGGA
GATCGACACACAGAAAATATTCTTATTTTTGATGATACTTGTGAATTAATGTTTATAGAC
TTTGAGTGTATTTTTAATATGGGTCGGACTTTAAGCCAACCAGAAACAGTTTTATTTCGC
TTAACTCCAGAAATGCAATCCGCTTTAGGTTTATTTTTTGAAGACTCTGAGTTTATAAAA
ACTTGTGCTATTGTTTTAAACTGTTTAAGATCTTATAAACATCTTATTATTAGTAATTTT
GAAAGCTTTATTACAGATCCACTTAGTGTGACATATACTAATCCTGATATTAGTGATAAT
GATATTGATCCGGTTAATACACTTAGGATTATACAAGCAAGACTTGATGGTAAGAATAAC
TATAAAAGTGATAATACTTATTATAATACTTTGCAGCAGGCTAAAGCTTTAGTTAAAGAT
GCTTCAGATTCAGAAAATCTTAGGAAAATGTGGCGTGGATGGGCACCATATCATTAG