Identifiers and Description

Gene Model Identifier

SteCoe_34725

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19093.0.g444.906094730649281e-35Ras family

Tetrahymena ThermophilaTTHERM_003899607.281290178321643e-33Rab II family protein; small m
onomeric GTPase that regulates
membrane fusion and fission e
vents
WormBaseWBGene000042741.603810890548638e-28
Saccharomyces CerevisiaeYER031C8.75651076269652e-27Rab family GTPase; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi; YPT31 ha
s a paralog, YPT32, that arose
from the whole genome duplica
tion

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34725(Protein)
MQITKDEDYDFLYKIVIIGEAGVGKTHLLSKYIKGTLPKNPTSTIGVEFATRTVPLPSGG
TVKAQIWDTAGQERYRAITCAHYRRSIGALLVYDITNEKSFGACKRWMEELRDQAEPDIV
IMLVGNKLDLVEKNRENRKVLRETAEKFAKANSLLFQETSTFTGDNVKEAFEGLLQNIYQ
TKSQAGGGRGRESGANRLVANPQMDISSKSCCN


>SteCoe_34725(CDS)
ATGCAGATAACAAAAGACGAAGACTACGACTTTCTATACAAAATCGTAATAATTGGTGAA
GCAGGTGTAGGTAAAACCCACCTTTTATCTAAATACATCAAAGGAACACTTCCTAAAAAT
CCAACATCTACAATTGGTGTAGAATTCGCTACAAGGACAGTTCCTTTACCATCTGGTGGT
ACAGTCAAAGCTCAAATATGGGACACAGCTGGTCAAGAGCGTTATAGAGCAATAACATGT
GCTCATTATCGTCGTTCTATAGGTGCATTATTAGTTTATGATATTACAAACGAGAAGTCT
TTTGGTGCATGTAAAAGATGGATGGAAGAGCTTAGAGATCAAGCTGAACCAGATATTGTT
ATTATGTTAGTTGGGAATAAGCTTGATTTGGTTGAAAAAAATAGGGAAAATAGGAAGGTT
CTTAGGGAAACTGCGGAAAAATTTGCCAAAGCGAACAGTTTGCTGTTTCAAGAGACGTCA
ACTTTTACTGGGGATAATGTGAAAGAAGCGTTTGAAGGACTGTTGCAAAATATTTATCAA
ACTAAGTCTCAGGCAGGAGGAGGACGTGGAAGGGAATCAGGAGCGAATAGATTGGTTGCT
AACCCACAGATGGATATTTCGTCGAAGTCTTGTTGTAATTAA