Identifiers and Description

Gene Model Identifier

SteCoe_34785

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYER117W1.462486227251231e-31Ribosomal 60S subunit protein
L23B; homologous to mammalian
ribosomal protein L23 and bact
erial L14; RPL23B has a paralo
g, RPL23A, that arose from the
whole genome duplication
WormBaseWBGene000044352.9374821117108028e-30
Oxytricha TrifallaxContig861.1.g245.900090541597061e-29Ribosomal protein L14p/L23e

Tetrahymena ThermophilaTTHERM_002971404.780892883885469e-25Homolog of Yeast RPL23, Human
RPL23, Bacteria RPL14; Ribosom
al protein L14p/L23e containin
g protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34785(Protein)
MSKRGRSGATGIKMRVTLALPVGARINCADNTGAKILYIMAVTRFGARLNRLPAASIGDM
VLVTVKKGKPELRKKVMPAVVIRQRKSWRRADGVFICCEDNAGVIVNPKGEMKGSGVSGP
VTKECADLWPRVAAHAGAIV


>SteCoe_34785(CDS)
ATGAGTAAAAGAGGAAGGTCAGGAGCGACAGGCATCAAAATGCGAGTAACTTTAGCCCTT
CCAGTAGGAGCTAGGATTAACTGTGCAGATAACACTGGAGCCAAAATCCTTTACATAATG
GCTGTGACTAGATTTGGAGCTAGATTGAACAGACTTCCAGCTGCATCAATTGGCGATATG
GTATTAGTAACAGTGAAAAAAGGGAAACCAGAACTTAGGAAAAAAGTTATGCCTGCTGTA
GTCATTCGACAACGTAAATCATGGAGACGAGCTGATGGGGTATTTATATGCTGTGAAGAT
AATGCAGGGGTTATTGTTAACCCTAAGGGAGAAATGAAAGGATCAGGTGTTTCAGGACCT
GTGACAAAAGAATGTGCTGATTTATGGCCAAGAGTTGCAGCACATGCTGGAGCGATAGTT
TAA