Identifiers and Description

Gene Model Identifier

SteCoe_34804

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10327.0.1.g1140hypothetical protein

WormBaseWBGene000001600
Saccharomyces CerevisiaeYKL135C2.572209372642415e-56Beta-adaptin subunit of the cl
athrin-associated protein (AP-
1) complex; binds clathrin; in
volved in clathrin-dependent G
olgi protein sorting; protein
abundance increases in respons
e to DNA replication stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34804(Protein)
MAYFTNTRRGEIPELQEELNSVKHEQKKEAVKKVIAAMTVGKDVSALFPHVVKCMEIQNV
ELKKLIYLYIINYAKTQPDLAIMAVNSFRKDAKNPTSPLIRALAVRTMGCIRVERITEYL
CEPLKEALRDEDPYVRKTAAICVSKLYDIAPDLVEDTDFLNILSAGLNDGNALVLSNTVA
AITEISEMRGKPVITLTPQIINRILAALNEATEWGQVFILDYISTYTPTDSKEAESIVER
ITPRLAHANPAVVLSAIKVIVKYLDLITAVDVVRNVVKKVAPSIVSLINSEAEIQYVALR
CINLILQKRPTILDKEVRVFFCKYNDPIYVKMEKLDIIVRMTDGKNIDQVLHELKDYSTE
IDVEFVKKAIQAIGRCAIKLEKTVDKCVGALVDLVKMKVQYAVQEILIVMKDIFRRYPNR
FEMVIKDIFNNIEVLDSPESKSAFIWILGEYAEKIDDAEVQLRAQAENFKDEQLQVQLQI
LTAVVKLFLKKPDQGESLITELLRIATEECPNPDLRDRAYIYWRLLSSDPEATKKVVLCE
KPLISETSYIYESSYLDKLIDQLGTIAAVYHKVHETKLSKIKAIEKEEAEKEEIETPVIN
PNNLLDQDLIGEGEGKRSVKAKVPMQTVLSNSTPGINQQSGLQIEMAFQREDCTILEAKF
TNFTQTVLNDFAMQFNVNHFGLTLQEPLSLEPLAPGASSMSKIRISSSGQRDQNLPGVPL
IIQIAVRCTLDVFYFQTPCMFTALLSDSGALSKDDYKSQWKVLPDENEFSHVIAPLHPNY
NSLQSLQERLGNNNIFMVASRKNAENEEVMYYXEFSHVIAPLHPNYNSLQSLQERLGNNN
IFMVASRKNAENEEVMYYSSQINTGEAILTELRTPQNLSKVYVACKTLPHLAPLFIQAIN
FLLSTVS


>SteCoe_34804(CDS)
ATGGCTTACTTTACTAACACTAGGAGAGGTGAAATACCAGAACTCCAAGAAGAGCTAAAC
TCTGTCAAGCACGAGCAAAAAAAGGAAGCCGTGAAAAAAGTTATAGCCGCAATGACCGTA
GGCAAGGACGTGTCAGCTCTTTTCCCTCACGTGGTCAAGTGTATGGAGATTCAGAACGTC
GAACTCAAAAAATTAATTTATCTCTACATAATCAATTACGCCAAGACTCAACCTGACTTA
GCCATTATGGCTGTAAATTCATTCCGAAAAGATGCAAAAAACCCAACATCTCCTCTTATC
CGAGCTTTAGCTGTAAGAACAATGGGTTGTATTCGTGTAGAAAGAATAACTGAATATTTA
TGTGAACCATTAAAAGAAGCATTAAGAGATGAAGATCCATATGTTAGAAAAACTGCAGCA
ATATGTGTATCTAAACTTTATGATATAGCCCCAGATTTAGTTGAAGATACTGATTTCCTT
AATATTCTTTCAGCAGGATTAAATGATGGTAATGCTTTAGTACTGTCTAATACTGTAGCA
GCTATAACTGAAATAAGTGAAATGCGTGGTAAACCAGTGATAACTTTGACTCCACAGATT
ATTAATAGAATCCTCGCAGCTTTGAATGAAGCTACTGAATGGGGACAGGTATTTATTTTA
GATTATATTAGCACATATACACCTACAGATTCAAAAGAAGCGGAAAGTATTGTTGAAAGA
ATTACCCCAAGACTTGCTCATGCAAATCCTGCTGTTGTCCTTTCAGCTATAAAAGTTATT
GTCAAATACCTTGATCTTATCACAGCAGTTGATGTTGTGAGAAATGTGGTTAAAAAAGTC
GCTCCAAGTATTGTCTCGCTTATAAACTCAGAAGCTGAAATCCAATATGTCGCCCTAAGG
TGCATAAATTTGATTTTACAGAAACGCCCGACAATTTTAGACAAGGAAGTTAGAGTTTTT
TTCTGTAAATATAATGACCCAATTTATGTGAAAATGGAGAAACTTGATATTATTGTAAGG
ATGACAGATGGGAAAAATATAGACCAAGTACTTCATGAGCTTAAAGATTACTCAACAGAA
ATCGATGTTGAGTTTGTTAAAAAAGCTATTCAAGCTATAGGCAGATGCGCAATCAAGCTT
GAAAAAACTGTTGACAAGTGTGTTGGAGCCTTAGTGGACTTAGTTAAAATGAAAGTCCAA
TATGCAGTACAAGAAATACTTATTGTCATGAAGGATATATTTAGAAGATACCCAAACAGA
TTTGAAATGGTTATCAAAGATATCTTTAATAATATTGAAGTTTTAGATAGTCCAGAAAGT
AAGTCAGCCTTTATATGGATTTTAGGTGAATATGCAGAAAAAATCGATGATGCTGAAGTG
CAGCTTCGAGCCCAAGCTGAGAATTTTAAAGATGAACAACTACAAGTCCAGCTTCAGATT
CTTACAGCAGTTGTCAAGCTGTTTTTAAAGAAGCCTGATCAGGGTGAGAGTTTAATAACT
GAACTCTTACGTATTGCAACTGAAGAATGCCCAAATCCTGACCTCCGTGACAGGGCTTAT
ATATACTGGAGGTTACTATCTTCAGACCCAGAAGCTACAAAAAAAGTCGTCCTCTGTGAA
AAACCTCTTATTTCTGAGACGAGCTACATTTATGAAAGCTCATATTTAGATAAACTTATA
GACCAACTAGGGACAATAGCTGCGGTTTATCATAAAGTTCATGAAACTAAGCTCAGTAAA
ATTAAAGCAATAGAAAAAGAAGAGGCTGAAAAAGAAGAAATTGAAACTCCAGTTATAAAC
CCAAATAACTTATTAGACCAAGATCTTATTGGTGAAGGTGAAGGAAAAAGATCAGTAAAA
GCTAAAGTCCCAATGCAGACTGTTTTAAGCAATTCAACCCCAGGAATCAATCAACAAAGT
GGTCTTCAGATTGAAATGGCTTTTCAAAGAGAAGACTGTACTATTCTTGAAGCTAAATTC
ACGAATTTTACTCAGACAGTTTTAAATGATTTCGCTATGCAATTTAATGTTAATCATTTT
GGATTAACTCTTCAAGAGCCATTAAGCCTTGAACCTTTAGCTCCAGGAGCTTCATCAATG
AGTAAAATTAGGATTTCTAGCTCAGGACAAAGAGACCAAAATCTTCCAGGAGTTCCTTTG
ATAATACAAATAGCTGTCAGGTGTACTTTGGATGTTTTTTACTTTCAGACGCCTTGTATG
TTCACAGCTTTACTTAGTGATTCTGGAGCTTTATCTAAAGATGATTATAAAAGTCAATGG
AAAGTACTTCCTGATGAAAACGAGTTCAGTCATGTTATTGCACCTTTACATCCGAATTAT
AATTCTTTACAATCTTTGCAAGAGAGGTTGGGGAATAATAACATTTTTATGGTAGCTTCA
AGGAAAAATGCGGAGAATGAAGAAGTTATGTATTACANTGAGTTCAGTCATGTTATTGCA
CCTTTACATCCAAATTATAATTCTTTACAATCTTTGCAAGAGAGGTTGGGAAATAATAAC
ATTTTTATGGTAGCTTCAAGGAAAAATGCGGAGAATGAAGAAGTTATGTATTACAGTAGT
CAAATAAATACAGGAGAGGCTATACTTACTGAATTGAGAACGCCACAGAATTTAAGTAAG
GTTTATGTGGCGTGTAAGACTTTACCACATCTTGCCCCATTGTTTATTCAAGCAATTAAC
TTTTTATTATCAACAGTTAGTTAA