Identifiers and Description

Gene Model Identifier

SteCoe_34837

Standard Name

None

Aliases

None

Description

NEK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22041.0.g315.166420632837861e-55Protein kinase domain

Tetrahymena ThermophilaTTHERM_001883901.2479464629129513e-47NIMA-Related Kinase
WormBaseWBGene000226318.75651076269652e-27
Saccharomyces CerevisiaeYAR018C4.248354255291589e-18Nonessential serine/threonine
protein kinase; possible role
in DNA damage response; influe
nces tolerance to high levels
of ethanol

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34837(Protein)
MSYSASYQEITIIGRGNFGAAFLVQNKQTGEKLVAKKILLTGLSDKEIQGAYQEAELLKR
LNHPNIVTYRDSFCEFGHLIIVMEYCDVGDLAYHVKEKNKKNEFFTEAEVMNWFVQICMS
LQYIHKLGILHRDIKTSNIYLTGNNTVKLGDFGISKVLQGSEAAMTVVGTPYYMSPEVCE
GHPYSYKSDAWSLGCVLYELCTLKHAFSANNLLGLVFKIVSGTAEPIPNRYSPQLRRIVS
SMLAKDTNTRLSVQDVMHDSYILSFMQNFIASDGQEVKRQLTIRKPIVAEERPADRSPTK
IVDESPKERIARLKREKADEEFEKMKRATKDAFVGNQITQQRKYDMLYSTPSTRALNEVQ
TRNQMSPPSDLSGSGSTIASIAFTNRKSFDKKQPEDNFELSITDMQDLNSQANYEYYLKY
SGDMPCEDKLGNTMEYSDTFEYSRTFPNLSQNAPPADNRAIKASGYYDLSTISEEPSQAG
CSDRNELTRVVDLYKSQIEKSNKYENESFSSPCDSCDRIISTDRRSAMRKKCIDQMGQAY
FDDVYGFLKQSRNRDLPDEVIFETAVKKWGKAANGYCLLVDQLLFLER


>SteCoe_34837(CDS)
ATGTCTTATAGTGCCAGCTATCAAGAAATTACAATCATAGGACGTGGGAATTTCGGAGCT
GCTTTTTTAGTTCAGAACAAACAAACTGGAGAAAAACTAGTGGCAAAAAAAATATTGCTA
ACAGGCTTATCAGATAAGGAAATCCAAGGCGCATACCAAGAAGCAGAATTACTAAAAAGG
CTTAACCATCCCAATATAGTCACATATCGAGACAGTTTTTGCGAGTTTGGGCACTTAATC
ATAGTTATGGAATACTGTGACGTAGGAGATCTCGCATATCATGTGAAAGAAAAAAACAAG
AAAAATGAGTTTTTCACTGAAGCTGAGGTTATGAATTGGTTCGTTCAAATCTGCATGTCT
TTACAATACATCCATAAACTTGGTATTCTTCATCGTGACATAAAAACCTCAAACATTTAT
CTTACAGGGAACAATACAGTAAAACTTGGGGATTTTGGAATATCAAAAGTTCTTCAAGGA
TCTGAAGCAGCAATGACTGTTGTTGGCACTCCTTATTACATGTCACCTGAAGTCTGTGAA
GGTCATCCTTATAGTTATAAGTCTGATGCATGGAGCTTAGGTTGTGTACTTTATGAGCTC
TGTACTCTTAAACATGCTTTTTCAGCAAATAACCTTCTGGGCCTAGTCTTCAAAATTGTC
TCAGGGACTGCTGAACCAATACCAAATCGATATTCTCCTCAATTAAGAAGAATAGTCTCA
TCAATGCTCGCAAAAGATACTAATACTAGACTTTCTGTTCAAGATGTTATGCATGATTCT
TACATTTTGAGCTTTATGCAAAATTTTATTGCTTCAGATGGACAAGAAGTAAAAAGACAA
CTGACTATAAGAAAACCAATAGTTGCCGAAGAAAGACCTGCTGATAGAAGTCCTACTAAA
ATTGTGGATGAGTCGCCTAAAGAAAGAATAGCACGGCTTAAAAGAGAAAAAGCTGATGAA
GAGTTTGAGAAAATGAAAAGAGCTACTAAAGATGCTTTTGTTGGAAATCAAATAACGCAA
CAGAGAAAATATGATATGCTTTACTCAACACCTTCAACAAGAGCTTTAAATGAAGTTCAG
ACAAGAAACCAGATGTCTCCTCCTTCGGATTTAAGTGGAAGTGGGTCGACTATTGCTTCT
ATAGCTTTTACTAATAGAAAATCTTTTGATAAGAAACAGCCTGAAGATAATTTTGAATTG
AGCATAACAGATATGCAGGATTTAAATAGCCAGGCGAATTATGAGTATTATTTAAAATAT
TCAGGAGATATGCCCTGTGAAGACAAATTAGGAAATACGATGGAGTATTCAGACACTTTT
GAATATTCAAGAACTTTCCCTAATCTTAGTCAAAATGCGCCACCAGCAGACAATCGTGCT
ATTAAAGCATCAGGCTATTACGATTTAAGCACAATTTCAGAAGAACCTTCTCAAGCAGGG
TGCAGTGACCGGAATGAGTTAACTCGAGTAGTTGATTTATATAAAAGCCAGATTGAAAAA
TCAAACAAATATGAAAACGAGAGCTTTTCTTCTCCTTGTGATTCTTGTGATAGAATTATT
AGCACTGACAGACGGTCAGCTATGAGGAAAAAATGTATCGACCAAATGGGTCAGGCTTAC
TTTGATGATGTTTATGGATTTCTTAAACAGTCTAGGAATAGAGACTTACCTGATGAAGTG
ATTTTTGAAACAGCAGTAAAAAAATGGGGGAAAGCAGCGAATGGATATTGCCTACTTGTT
GATCAGTTGCTTTTCTTAGAACGATAA