Identifiers and Description

Gene Model Identifier

SteCoe_34856

Standard Name

None

Aliases

None

Description

RIO family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000466801.2479464629129513e-47serine kinase involved in proc
essing of the 20S pre-rRNA i
n
to mature 18S rRNA
Oxytricha TrifallaxContig20358.0.g821.2479464629129513e-47RIO1 family

WormBaseWBGene000196981.368539471173853e-44
Saccharomyces CerevisiaeYOR119C1.3336148155022614e-34Serine kinase involved in cell
cycling and pre-rRNA processi
ng; associated with late pre-4
0S particles via its conserved
C-terminal domain and partici
pates in late 40S biogenesis;
association with pre-40S parti
cles regulated by its catalyti
c ATPase site and likely occur
s after the release of Rio2p f
rom these particles; involved
in cell cycle progression and
processing of the 20S pre-rRNA
into mature 18S rRNA; essenti
al gene

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34856(Protein)
MSSSDDNEDLAYEYDFTSLKGTKYQELEQKFSTKINDSFIRLPTLANSAISKIKEIEKKN
DENRIRFKDKGDRATVELVLDRRTRIVLFKLINSEKISEIFGCVSAGKEANVYYAINTSQ
QEFAIKIYKTSILVFKDRHRYVEGEFRFRHGYARHNPRQMVAMWAEKEMRNLKRLQVAGI
PCPEPLFVKQNVLLMSFIGRDAKAAPRLKEVGFGGRVEEFYRQTVDLMRDMYHKCKLVHA
DFSEYNLLYFEDRVYVIDVSQSVEHDHPQALYFLRRDCSNINDFYKKNGAAVLTVQGIFN
YITDITESSDEIRWEKAKSTEEISDAVFKEIYIPRTLQELQETGQDESIFGKLTGVSKKP
QTNEEDQSLSESDENPNTEDQDKKKHGDILYEGLSKQERKAKVKEDKREKRKSKIPKHVK
KQKMKKTKH


>SteCoe_34856(CDS)
ATGTCGAGTTCTGATGATAATGAAGACCTTGCTTACGAATATGACTTCACTTCACTAAAA
GGGACGAAATATCAAGAACTCGAACAAAAGTTCTCAACAAAAATCAACGATTCATTCATC
CGTTTGCCTACTCTTGCTAACAGTGCAATTTCTAAAATCAAAGAAATCGAGAAAAAAAAC
GATGAAAATCGTATCAGATTTAAAGACAAAGGGGATAGAGCAACTGTTGAACTAGTCTTA
GATCGTCGAACACGTATAGTTCTTTTCAAACTCATCAACTCCGAAAAAATTTCTGAGATT
TTTGGCTGTGTTTCCGCAGGTAAAGAAGCTAATGTTTATTATGCGATCAACACTTCTCAA
CAAGAATTCGCTATAAAAATTTATAAAACATCGATTTTAGTGTTTAAAGATAGACATCGT
TATGTTGAAGGAGAATTTAGATTTAGACATGGATATGCAAGACATAATCCAAGACAAATG
GTTGCTATGTGGGCTGAGAAGGAAATGAGGAATTTAAAAAGATTACAAGTTGCTGGAATA
CCGTGTCCTGAACCTTTGTTTGTTAAACAGAATGTTTTGTTGATGAGTTTTATTGGTAGA
GATGCTAAAGCGGCTCCTAGGCTTAAGGAAGTTGGGTTTGGTGGAAGAGTTGAAGAGTTT
TATAGGCAGACAGTTGATTTGATGAGGGATATGTATCATAAGTGTAAGTTGGTACATGCG
GATTTTAGTGAATATAATTTGTTGTATTTTGAGGATAGGGTTTATGTTATTGATGTGTCG
CAGTCGGTGGAACATGATCATCCACAGGCTTTGTATTTCCTTAGGAGAGACTGTTCTAAC
ATCAACGACTTTTACAAGAAAAACGGGGCAGCAGTGCTAACAGTGCAAGGGATTTTCAAC
TACATCACCGACATAACTGAGTCATCAGACGAGATCCGCTGGGAAAAAGCTAAATCAACC
GAAGAGATTTCCGATGCCGTATTCAAAGAAATCTACATCCCAAGAACTCTCCAAGAGCTC
CAAGAAACCGGTCAAGACGAGTCAATTTTCGGCAAGCTCACCGGTGTAAGCAAAAAACCC
CAAACAAACGAAGAAGATCAAAGCCTAAGCGAATCAGACGAGAACCCAAACACCGAAGAC
CAAGACAAAAAAAAGCATGGCGACATCCTCTATGAAGGTCTAAGTAAACAAGAGCGTAAG
GCAAAAGTCAAAGAAGACAAGAGAGAAAAGCGGAAAAGCAAAATCCCGAAACACGTCAAA
AAGCAGAAAATGAAAAAAACCAAGCATTAA