Identifiers and Description

Gene Model Identifier

SteCoe_35015

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000044134.7111658015535965e-58
Tetrahymena ThermophilaTTHERM_007162407.667648073722e-53Homolog of yeast RPL2, human R
PL2; C-terminal domain contain
ing protein, Named RPL8 in Kli
nge et al. Science 2011
Saccharomyces CerevisiaeYIL018W2.0842828425817514e-52Ribosomal 60S subunit protein
L2B; homologous to mammalian r
ibosomal protein L2 and bacter
ial L2; RPL2B has a paralog, R
PL2A, that arose from the whol
e genome duplication; expressi
on is upregulated at low tempe
ratures
Oxytricha TrifallaxContig22518.0.g911.8521167695179754e-45Ribosomal Proteins L2, C-termi
nal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35015(Protein)
MGRRIRAQRKGRGSVFRAHVTHRKGAAGFRVLDYAERNGYIKGVVKEIIHDPGRGAPLAK
VLFRDPYRYRQHIETFIATEGMYSGQFVYCGKKAQLVVGNVLPVGNLPEGTEVCNVEERA
GDGGALGRASGTTATVIGHSDDGLQTRVKLPSGSRKAIDSSCRAMVGIVAGGGRNDKPLL
KAGRSYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHPSTVRRDAPPGQKAGLVAA
RRTGRIRGAKEIKD


>SteCoe_35015(CDS)
ATGGGGCGTAGGATTAGAGCTCAGAGGAAAGGACGAGGAAGCGTTTTCAGAGCCCATGTG
ACTCACAGAAAGGGCGCTGCAGGGTTTCGAGTGCTAGACTATGCTGAGCGTAATGGTTAC
ATCAAAGGAGTTGTCAAGGAAATCATCCACGATCCAGGGCGTGGTGCACCTTTAGCTAAA
GTGTTGTTCAGGGACCCATACAGGTACAGACAACATATTGAAACTTTTATCGCAACAGAA
GGAATGTACTCTGGACAATTCGTCTATTGTGGTAAAAAAGCCCAACTAGTGGTCGGGAAT
GTCTTACCAGTCGGCAACCTTCCTGAAGGTACAGAAGTGTGTAACGTAGAAGAGAGAGCA
GGAGATGGAGGTGCACTTGGAAGAGCTTCAGGGACAACTGCAACTGTTATTGGGCACTCT
GATGATGGACTACAAACTCGTGTTAAATTACCCAGTGGCTCAAGAAAAGCTATTGACTCA
TCATGTAGAGCTATGGTTGGGATTGTTGCAGGTGGTGGAAGAAATGATAAACCATTACTA
AAAGCTGGGAGATCATATCATAAATACAGAGTTAAAAGAAACTGCTGGCCTAAGGTTAGA
GGTGTGGCTATGAATCCTGTAGAGCATCCTCATGGTGGAGGTAATCATCAGCATATTGGG
CATCCTAGCACTGTTAGAAGAGATGCTCCTCCAGGACAGAAAGCAGGTCTTGTTGCTGCT
AGAAGGACCGGTAGAATTAGAGGTGCTAAAGAAATTAAAGATTAA