Identifiers and Description

Gene Model Identifier

SteCoe_35059

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004751402.0842828425817514e-52protein disulfide-isomerase do
main containing protein
Oxytricha TrifallaxContig9681.0.g594.1863939993042314e-51Thioredoxin

WormBaseWBGene000039639.221146422925876e-47
Saccharomyces CerevisiaeYCL043C2.3802664086944007e-26Protein disulfide isomerase; m
ultifunctional protein of ER l
umen, essential for formation
of disulfide bonds in secretor
y and cell-surface proteins, u
nscrambles non-native disulfid
e bonds; key regulator of Ero1
p; forms complex with Mnl1p th
at has exomannosidase activity
, processing unfolded protein-
bound Man8GlcNAc2 oligosacchar
ides to Man7GlcNAc2, promoting
degradation in unfolded prote
in response; PDI1 has a paralo
g, EUG1, that arose from the w
hole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35059(Protein)
MAARMLLGLVLALGVFGEITEEEGVWVLNEANFDEALSIQPNMLIEFYAPWCGHCKKLAP
EYAKAAQKLAKNNPPIRIAKVDATANTELAKKYKVEGYPTLKYFVNKTPIEYTGGRTEDT
IVSWILKKNTPTVSFFSNSVDLKNFIDLYKVVVVLFANKDSEKVGIIEVVGKSFDSVTFA
VATDAESAAEYGVSDSGLIILKKFDDKRADFQGKFNNAEITKFINEHRFPWVMPFGDDAI
ELIFKKSSPGLFLFCSSYSEFQNAMETLSKEFKGTLAFTWADLKSKDNSKLSEHLGIVGS
DQPTSVIVDPRGGDNKKYRFSGQVSYDSLKEFINNWTSKKLEPYLKTQDVPQNSYDGSVR
VLVGKNFEEVVFDKEKDVLVEFYAPWCGHCKKLAPEYEKLAEELKGIPSVVIAKMDSTVN
EAKGVAIKGFPTLKFYRANNKSPMDYSGDRNFDGLLKFVKDNASIKFETTQKVDL


>SteCoe_35059(CDS)
ATGGCAGCCAGAATGTTACTAGGTTTGGTTCTAGCTCTAGGAGTTTTTGGAGAAATCACT
GAAGAAGAAGGAGTTTGGGTGTTAAACGAAGCAAATTTCGATGAAGCCCTTAGTATTCAG
CCTAACATGCTTATCGAGTTTTATGCTCCATGGTGTGGGCATTGCAAGAAACTCGCTCCT
GAATACGCAAAAGCTGCTCAAAAATTAGCGAAAAACAATCCACCCATAAGAATTGCTAAA
GTTGATGCCACAGCTAATACTGAATTAGCTAAAAAATATAAAGTTGAAGGATATCCAACA
TTGAAGTATTTTGTCAATAAAACCCCTATTGAATATACTGGAGGAAGGACTGAAGACACA
ATTGTATCTTGGATTTTGAAGAAAAATACCCCAACTGTTTCTTTTTTCTCTAATTCAGTG
GATTTAAAGAACTTTATTGATTTATATAAAGTTGTTGTTGTACTTTTCGCTAATAAGGAT
TCAGAAAAAGTTGGGATCATTGAAGTTGTTGGGAAAAGCTTTGATTCAGTAACTTTTGCT
GTGGCAACTGATGCTGAATCAGCTGCGGAATATGGTGTTTCGGATTCGGGGCTGATAATA
TTGAAGAAATTTGATGATAAAAGAGCTGATTTCCAAGGCAAGTTTAACAACGCAGAAATT
ACAAAATTCATCAACGAGCATCGTTTTCCTTGGGTAATGCCATTCGGCGACGACGCTATC
GAGCTTATATTCAAAAAATCCTCTCCAGGTCTCTTCCTCTTCTGCTCATCCTACTCTGAA
TTCCAAAATGCCATGGAAACCTTAAGCAAAGAATTCAAAGGCACCCTAGCTTTCACATGG
GCAGACTTGAAATCCAAAGATAACTCCAAATTATCTGAACATTTAGGCATAGTTGGATCA
GATCAACCAACATCAGTAATAGTTGATCCAAGAGGTGGTGATAATAAAAAATATAGATTT
TCAGGACAAGTTTCATATGATTCATTAAAAGAATTCATAAACAATTGGACAAGTAAAAAA
CTAGAACCATATTTAAAAACTCAAGATGTTCCTCAAAATAGTTATGATGGATCAGTAAGA
GTTCTTGTTGGTAAGAATTTTGAAGAAGTTGTTTTTGATAAAGAAAAAGATGTTTTGGTT
GAGTTTTATGCACCTTGGTGTGGACATTGTAAGAAACTTGCCCCTGAATATGAAAAGTTA
GCTGAAGAACTTAAAGGAATACCTTCAGTGGTTATTGCTAAGATGGACTCTACAGTTAAT
GAAGCTAAAGGAGTTGCGATTAAAGGATTCCCTACATTGAAGTTTTATAGAGCTAACAAT
AAGAGCCCTATGGATTATAGTGGGGATAGGAACTTTGATGGACTTTTGAAGTTTGTTAAG
GATAACGCAAGCATCAAGTTTGAAACTACCCAAAAAGTCGACTTATAG