Identifiers and Description

Gene Model Identifier

SteCoe_35065

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16838.0.g306.47023492564546e-26Core histone H2A/H2B/H3/H4

WormBaseWBGene000199476.47023492564546e-26
Tetrahymena ThermophilaTTHERM_001436601.4251640827409352e-21Histone H2A (variant H2A.Z); e
ssential protein; regulated by
acetylation, which modulates
charge patch on its N-terminal
tail; comprises about 20% of
total H2A protein in Tetrahyme
na; found only in transcriptio
nally active nuclei
Saccharomyces CerevisiaeYOL012C1.4251640827409352e-21Histone variant H2AZ; exchange
d for histone H2A in nucleosom
es by the SWR1 complex; involv
ed in transcriptional regulati
on through prevention of the s
pread of silent heterochromati
n; Htz1p-containing nucleosome
s facilitate RNA Pol II passag
e by affecting correct assembl
y and modification status of R
NA Pol II elongation complexes
and by favoring efficient nuc
leosome remodeling

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35065(Protein)
MPMNEEASGRGKGGKVSVSKQKKNPVSKSLKSGLQFPVGRIHRLLKQKVFSNHRVGATAA
VYAGAVLEYLTAEVLELAGNASKDQKVKRISPRHLQLAIRGDEELDSLIKATISGGGVIP
HIHKNLLLNPKEKILDS


>SteCoe_35065(CDS)
ATGCCCATGAACGAAGAAGCATCAGGTAGAGGAAAAGGGGGTAAAGTGTCTGTATCCAAG
CAAAAAAAAAATCCAGTTTCTAAATCTTTAAAATCAGGACTTCAATTTCCTGTAGGTAGA
ATCCATAGGCTATTAAAGCAAAAAGTTTTTTCGAATCATCGTGTCGGAGCAACTGCTGCA
GTTTATGCAGGGGCAGTACTTGAGTATTTAACTGCTGAAGTCCTTGAGCTTGCAGGAAAT
GCAAGCAAAGATCAAAAAGTGAAAAGAATAAGTCCAAGACATCTTCAGCTAGCGATAAGA
GGAGATGAAGAGCTCGATTCATTGATTAAAGCTACAATATCAGGAGGAGGTGTGATACCT
CATATCCATAAAAACTTGCTTCTAAACCCAAAAGAAAAAATCCTTGACTCATAG