Identifiers and Description

Gene Model Identifier

SteCoe_35384

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006007700.0000000007582560427911907Myosin heavy chain; member of
proposed myosin Class XX, dist
inct from previously defined m
yosin classes; contains predic
ted coiled-coil domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35384(Protein)
MEESIDSQAYTKEETPDNLIYISEHGEQTIYRCLSKRLSQGKFYTFAGPILISLNNEKSS
EAFSSKTQDAYAQGTAKDPHLYAISARVYKALQESKKNQVISLLGYSGAGKTFAAIHLLD
HLAHQAAFDTALFPILHSAMQIIHVMGSTSNSDNLESTVCGMIVNLSLDSRFKIAGASIK
AKLLDYSLPFTQTGKSYHILHSLTSASKTQLQSLGLSTCPSFKIFNSQTTTPSESTANSQ
NFERFIRNLNFLKFTRSDIQEILELLSCVILLFEINFVGNSFIIAGGEEYTEWTPRHRTA
IQRICKHLSVSEDKFLLIFQGLQHKSAVENKVRELARAIYNIAFEWMVYKINTKLKTYSA
NLIDKRLQLVKKLQQKEELEKISGIFGIAIVDFPGFHRNTTIGGFCSNLAFECLNLFSAD
KLIGLLHALNSDKVNMKIISQPLSKELISILMSKESGLLQSLDIENFDKYWKDFRVLYKD
SNYVTPCQNTLLVKYTWGEIEYDVFTLRQEALRFIHPSEFNSFFARCSNKLVQKLINTSE
FSLSNTFRKDLSLLLKPLIFYENSLIYFAKSNKQNLNYTETIRLLRNSLVFPCLFWHWYG
YEHWISNKKLMSDLAADCSPSQVVAFINTLLSQTLAEDDFVVGLHYTMFKDQAFKNLMEK
STNEKLKITAGATYKQIPQNLIRKTVRATSSKLLGISNGLFEYKVYGATPDLGNGMHEFL
ESVANIDEMSFKIENVSHISSNISVCSSQSTFKDTLQTVRSKKHFNSLKGSLSNFRLYNY
DESVYKIILIQKIWKGFLARRYYKAYQLLNSKAKKIQSLWKAYQAKKKYIDILTKTKKIQ
KAYKNHYWKKVSAAKIIQKWYKSLPKKKGIEEISSLVSSIKGIENPLIRLSRPIERKSKI
PIPKETFKPNILDYSRTLAKQREAKLTSEVLPVEKRLGLIEMMKNSKLDEMRKQKIEQEK
TNIKLKPQINKSHEFSNNFLQRQELKSQQIKMKIELEQRKKQSEELSTLTFRPKLKSSKS
SKSIERSVQDLHVWAELKKAELSKAQKAKVDEEARSLSPFHMSSTSKKILKQREDKMNLA
YKALNEYKETLVPYWPNKPNLDS


>SteCoe_35384(CDS)
ATGGAAGAATCTATTGATTCACAAGCTTATACAAAAGAAGAAACTCCTGATAACCTTATA
TACATTTCTGAGCATGGCGAGCAAACAATCTATAGATGCTTATCCAAGCGATTATCTCAA
GGAAAATTTTACACATTTGCCGGTCCAATCCTTATAAGCTTAAATAACGAAAAGAGCTCT
GAAGCATTTTCATCTAAAACTCAGGATGCATATGCACAAGGTACAGCTAAAGATCCTCAC
CTTTATGCAATAAGTGCCCGGGTTTACAAGGCTTTACAAGAAAGTAAAAAAAATCAAGTA
ATTTCTCTGTTGGGATACTCAGGAGCAGGAAAGACTTTTGCAGCAATTCATTTACTAGAC
CATTTAGCCCATCAGGCAGCATTTGACACAGCATTATTTCCAATACTTCATTCAGCAATG
CAAATAATCCATGTTATGGGCTCAACATCAAACTCAGATAACTTAGAATCAACTGTATGT
GGAATGATAGTAAATCTATCGTTAGATTCAAGGTTTAAAATAGCGGGAGCTAGTATTAAA
GCTAAGCTACTTGATTATAGTTTACCTTTTACTCAAACTGGAAAAAGTTATCATATTCTT
CATAGTTTGACCAGTGCTAGTAAAACTCAACTCCAATCTTTGGGCCTAAGCACATGTCCT
AGTTTTAAAATATTCAATAGTCAGACAACAACTCCTTCTGAGTCTACCGCCAACTCACAG
AATTTTGAAAGGTTCATACGAAACTTAAACTTCCTTAAATTCACACGTAGTGATATTCAA
GAAATCCTTGAACTTCTAAGTTGTGTTATTCTTTTATTTGAAATAAATTTTGTTGGCAAT
AGCTTTATTATTGCAGGTGGTGAAGAGTATACTGAATGGACTCCCCGTCATCGTACAGCA
ATCCAAAGAATCTGTAAGCACTTATCAGTATCTGAAGACAAATTCTTATTAATATTCCAA
GGTCTTCAACATAAAAGTGCAGTTGAAAACAAAGTGCGTGAGCTAGCTCGCGCTATCTAT
AACATAGCTTTTGAATGGATGGTATATAAAATCAATACAAAACTTAAGACTTACTCAGCA
AATCTAATCGACAAGCGTCTACAATTAGTTAAAAAGCTTCAGCAAAAAGAGGAATTAGAG
AAAATTTCAGGGATTTTCGGAATAGCTATAGTTGATTTTCCAGGTTTTCATAGAAACACA
ACAATAGGAGGTTTTTGTTCAAATTTAGCTTTTGAATGCTTAAACCTTTTTTCTGCAGAT
AAACTTATCGGTCTTCTTCATGCTTTAAATAGTGATAAAGTGAATATGAAAATCATTTCT
CAGCCTTTAAGTAAAGAACTTATCAGCATTCTTATGTCTAAAGAATCAGGCCTCCTCCAA
AGTTTAGATATTGAAAATTTTGATAAATATTGGAAAGATTTCAGAGTTTTATATAAAGAT
AGCAATTATGTGACTCCATGTCAAAATACCTTACTAGTAAAATACACTTGGGGTGAAATT
GAATATGATGTTTTTACTTTAAGGCAGGAAGCTTTAAGATTTATACACCCTTCTGAGTTC
AATTCTTTCTTTGCCCGCTGCTCTAATAAACTTGTTCAGAAACTTATAAACACAAGTGAA
TTTTCATTATCAAATACTTTCCGTAAAGACCTTTCACTTCTTTTAAAGCCTTTAATTTTT
TATGAAAACTCATTGATTTACTTTGCTAAATCTAATAAGCAAAATTTGAACTATACTGAG
ACTATTAGGCTTTTAAGGAATTCACTTGTATTCCCTTGTCTATTCTGGCATTGGTATGGA
TATGAGCATTGGATTTCAAATAAAAAACTTATGTCTGATCTTGCTGCTGATTGCTCCCCT
TCACAGGTTGTAGCTTTTATTAATACTTTATTGTCACAAACTTTGGCTGAAGATGATTTT
GTTGTCGGCTTGCATTATACTATGTTTAAAGATCAAGCATTTAAGAACTTAATGGAAAAA
AGCACTAATGAAAAGCTTAAAATCACAGCTGGAGCTACTTATAAGCAAATACCTCAAAAT
TTAATTAGAAAAACTGTCAGGGCGACTTCGTCTAAATTACTTGGAATATCAAATGGACTT
TTTGAGTATAAAGTTTATGGGGCAACACCTGATCTTGGGAATGGAATGCATGAGTTTTTA
GAAAGTGTTGCAAATATCGATGAAATGTCATTTAAAATTGAAAATGTATCTCATATTTCT
AGTAATATTTCAGTCTGTAGTTCACAAAGCACTTTCAAAGACACCTTGCAAACTGTCCGA
TCAAAAAAACACTTTAACTCCCTTAAAGGAAGCCTGAGCAACTTTCGCCTTTATAACTAT
GATGAGTCAGTATATAAAATTATTCTTATTCAAAAAATCTGGAAAGGGTTTCTAGCTAGA
AGATACTACAAAGCATATCAACTTCTTAACTCAAAAGCCAAAAAAATACAATCTCTTTGG
AAAGCATATCAAGCTAAAAAGAAATATATAGATATTCTTACAAAAACCAAGAAAATCCAA
AAAGCCTACAAAAATCATTATTGGAAAAAAGTATCAGCAGCAAAGATCATCCAAAAATGG
TACAAAAGCTTACCAAAAAAGAAAGGCATCGAAGAAATCAGTTCATTAGTAAGTTCAATC
AAAGGTATTGAGAATCCTTTAATTAGATTAAGCCGGCCTATTGAAAGAAAATCTAAAATA
CCTATTCCAAAAGAAACTTTTAAGCCAAATATATTAGACTACTCTCGTACTCTGGCCAAG
CAAAGGGAAGCAAAATTAACAAGTGAAGTTTTGCCTGTAGAGAAAAGATTAGGACTTATT
GAAATGATGAAAAATAGCAAATTAGATGAAATGAGAAAACAAAAAATAGAACAAGAAAAG
ACAAATATCAAACTAAAACCACAGATTAATAAGTCCCATGAATTCTCAAATAATTTCTTA
CAAAGACAAGAACTTAAATCACAACAGATAAAAATGAAAATAGAACTTGAACAAAGAAAA
AAACAATCAGAAGAACTTTCAACTCTTACTTTTAGACCTAAATTGAAATCATCTAAAAGC
TCTAAGTCAATAGAGAGAAGTGTCCAGGATCTTCATGTATGGGCTGAGCTTAAAAAAGCT
GAACTTAGCAAAGCTCAAAAAGCTAAAGTTGATGAAGAAGCTCGATCGTTGTCCCCATTC
CATATGTCTAGTACATCTAAAAAAATCCTTAAACAACGAGAAGACAAGATGAATTTGGCG
TATAAAGCACTTAATGAGTACAAAGAAACTCTTGTTCCTTATTGGCCTAATAAACCTAAT
TTGGATTCTTAA