Identifiers and Description

Gene Model Identifier

SteCoe_35451

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig578.1.g561.2479464629129513e-47ADP-ribosylation factor family


WormBaseWBGene000001833.392270193026015e-47
Saccharomyces CerevisiaeYDL137W5.0345753587649823e-45ADP-ribosylation factor; GTPas
e of the Ras superfamily invol
ved in regulation of coated fo
rmation vesicles in intracellu
lar trafficking within the Gol
gi; ARF2 has a paralog, ARF1,
that arose from the whole geno
me duplication
Tetrahymena ThermophilaTTHERM_007352408.194012623990515e-40ADP-ribosylation factor

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35451(Protein)
MGLAFSKIWQRLFGHREMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVERVEYRN
ISFTVWDVGGQDKIRPLWRYYYENIQGLIFVVDSNDRDRVDDAREELQRMLNEDQLRDVV
ILVFANKQDLPNAMTAAEVTDKLGLHAIRGRNWFIQSTCATSGDGLYEGLDWLSRTLSGK
KS


>SteCoe_35451(CDS)
ATGGGCTTAGCATTCTCAAAAATCTGGCAAAGACTTTTCGGGCACAGGGAAATGCGTATT
CTTATGGTCGGCTTAGACGCAGCAGGTAAAACAACAATTCTTTACAAACTCAAACTTGGT
GAAGTAGTCACAACAATTCCAACAATTGGTTTTAATGTTGAACGTGTAGAATACCGCAAC
ATTTCTTTCACAGTTTGGGATGTTGGTGGGCAAGATAAGATTAGACCTTTATGGAGATAT
TATTATGAGAATATTCAAGGTTTAATTTTTGTTGTTGACTCAAATGATAGAGACAGAGTT
GATGATGCTCGTGAAGAATTACAAAGGATGTTAAATGAAGATCAATTAAGAGATGTTGTT
ATATTAGTATTTGCTAATAAACAAGATTTACCTAATGCAATGACTGCTGCTGAAGTTACT
GATAAACTTGGCTTACATGCGATACGTGGAAGAAACTGGTTTATACAAAGCACTTGTGCT
ACAAGTGGAGATGGGCTTTATGAAGGATTAGATTGGTTATCAAGAACATTGTCTGGCAAG
AAAAGCTAA