Identifiers and Description

Gene Model Identifier

SteCoe_35454

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig5504.0.g722.1151310375910805e-19Ribosomal protein L10

Tetrahymena ThermophilaTTHERM_011515501.1548224173015786e-17Protein involved in mRNA turno
ver and ribosome assembly
WormBaseWBGene000173470.00000000000009357622968840175
Saccharomyces CerevisiaeYKL009W0.0000000000006914400106940203Protein involved in mRNA turno
ver and ribosome assembly; req
uired at post-transcriptional
step for efficient retrotransp
osition; localizes to the nucl
eolus

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35454(Protein)
MGKTSKRAQQVSLTKVKPKGKDHKNKQIKQVSAYIEIYPTIFAFQYQNFKTFPLQKLRES
FTTSRFLLGKGKVLQKALGQHKDLVNIEKFNKYLRGSCGLLFTKEPIESIIEFFITWRET
VSLLAGQTATETIVIPPGVGVFDKFSNTIEPYLRTIGLPTRVHEGKIEMLAEYHVCTAGE
VVGVEKAKILKLLNIQQGEMRIVLQAVWQGGNFKDLV


>SteCoe_35454(CDS)
ATGGGTAAAACTTCTAAGCGGGCCCAGCAGGTCTCTCTTACAAAGGTTAAACCCAAAGGC
AAAGACCATAAAAACAAACAAATAAAGCAAGTCTCAGCCTACATCGAAATCTACCCAACA
ATTTTTGCTTTCCAATACCAAAACTTCAAAACTTTCCCCTTACAAAAACTCCGTGAAAGC
TTTACAACAAGTAGATTCCTTTTAGGTAAAGGTAAAGTCTTACAAAAAGCTCTTGGTCAA
CACAAAGATCTTGTTAATATAGAAAAATTCAATAAATATCTTAGAGGGTCTTGTGGACTT
TTGTTTACAAAAGAACCAATCGAATCGATTATTGAGTTTTTCATTACATGGAGAGAAACT
GTAAGTTTATTAGCTGGACAAACAGCAACAGAAACTATAGTAATTCCTCCTGGTGTTGGG
GTTTTTGATAAGTTTTCTAATACAATTGAACCTTATTTAAGAACAATTGGACTTCCAACT
AGAGTTCATGAAGGGAAAATTGAAATGCTCGCAGAATATCATGTTTGTACAGCTGGGGAA
GTTGTGGGTGTAGAAAAAGCGAAAATACTTAAACTTCTCAATATACAACAAGGGGAAATG
AGAATTGTTTTGCAAGCAGTGTGGCAAGGAGGGAATTTTAAAGATCTGGTCTAG