Identifiers and Description

Gene Model Identifier

SteCoe_35463

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYPR058W3.975449735908647e-31Putative mitochondrial inner m
embrane transporter; proposed
role in oleate metabolism and
glutamate biosynthesis; member
of the mitochondrial carrier
(MCF) family; localizes to vac
uole in response to H2O2; YMC1
has a paralog, YMC2, that aro
se from the whole genome dupli
cation
Tetrahymena ThermophilaTTHERM_006271801.0806392777072785e-30Mitochondrial carrier protein
WormBaseWBGene000083202.1151310375910805e-19
Oxytricha TrifallaxContig13637.0.1.g280.0000000000002543665647376923Mitochondrial carrier protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35463(Protein)
MGELGIKEFIGGTVGGIAQVLSGQPFDIIKVRQATSVTPINAMSAALTMVKQEGVLAFWR
GSTAPLLGVGACVSIQFGVLENSKRLVQKSKGKSLETWDYIFCGAIAGMANTIVSAPAEH
FRIKMQVQGKVDPRGDPLYKSDGDCIKSIFKNHGIAGAYRGFWITLLREAVTFGSYFGAY
EYIVNYHLIPKGGTKKDVEAWKLFCTGGFSGYFYWAPWYPIDAIKSKLQADSFTNPRFNG
FIDCAKKTLASEGLAGFYKGFWPCMLRAFPVNATTFLAYELTMRVIS


>SteCoe_35463(CDS)
ATGGGTGAACTAGGGATTAAAGAGTTTATCGGAGGCACAGTCGGAGGAATAGCTCAAGTT
TTATCAGGACAGCCATTCGATATCATAAAAGTCCGCCAAGCAACAAGCGTAACTCCAATA
AATGCAATGTCAGCAGCTCTTACTATGGTAAAACAAGAAGGAGTCTTAGCTTTTTGGCGT
GGTTCAACAGCTCCATTATTAGGTGTAGGAGCATGTGTATCAATACAATTTGGTGTACTT
GAAAACTCTAAAAGATTAGTCCAAAAATCTAAAGGTAAAAGCTTAGAAACTTGGGATTAT
ATATTTTGTGGAGCTATAGCAGGTATGGCAAATACAATAGTCTCAGCTCCAGCTGAGCAT
TTTAGAATAAAAATGCAAGTACAAGGTAAAGTTGATCCAAGAGGTGATCCTTTATATAAA
AGTGATGGAGACTGTATTAAATCAATATTCAAAAATCATGGTATAGCAGGAGCTTATAGA
GGTTTTTGGATAACATTATTAAGAGAAGCTGTAACTTTTGGTAGTTATTTTGGTGCTTAT
GAATATATTGTCAATTATCATTTAATACCTAAAGGAGGAACTAAAAAAGATGTTGAAGCT
TGGAAACTATTTTGCACTGGTGGATTTAGTGGGTATTTTTATTGGGCACCTTGGTATCCT
ATTGATGCTATTAAGTCTAAATTACAAGCTGATTCTTTTACTAATCCAAGATTTAATGGG
TTTATTGATTGTGCTAAAAAAACTCTTGCTTCAGAAGGACTTGCTGGGTTTTATAAAGGA
TTTTGGCCTTGCATGCTTAGAGCTTTTCCGGTGAATGCTACAACTTTTCTTGCTTATGAG
TTGACGATGAGAGTTATTTCGTAA