Identifiers and Description

Gene Model Identifier

SteCoe_35621

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005008101.2160992992528256e-37Glucosyltransferase, involved
in transfer of oligosaccharide
s from dolichyl pyrophosphate
to asparagine residues of
prot
eins during N-linked protein g
lycosylation
Saccharomyces CerevisiaeYOR002W1.462486227251231e-31Alpha 1,3 glucosyltransferase;
involved in transfer of oligo
saccharides from dolichyl pyro
phosphate to asparagine residu
es of proteins during N-linked
protein glycosylation; mutati
ons in human ortholog are asso
ciated with disease
WormBaseWBGene000074357.984904245686979e-30
Oxytricha TrifallaxContig22850.0.g165.900090541597061e-29ALG6, ALG8 glycosyltransferase
family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35621(Protein)
METICKTRLAKEKEILKRMESKNTKITLSHDDRSVEVIFSIFSTNITYYINLPERYPFLP
PMITVNIPSTITSLYSESSDLLPLIIEDTWTPSINLQTLIENIALFNTKSLSQNKASQIG
GLSLWSIVLISIIFRVAMYSQSYSGHYTPPLYGDYEAQRHWMELTYNFPAEMWYKDTIET
DPGYWKLDYPPLTAWHSYFCGLISAVYEPESMELDKSRGYYTESHLMFMRTTVLISEIIV
YIPAVIVFFTVFNMSFQQKIRNMGLLLFLMSPPLILIDYGHFQYNNLMLGFALVSTLMTV
YGYYSAAAIFLALGINFKIMSLYYILPLGILWVVVAWDQGLRERYRLGGNLKYIVQSFVT
MSGIIAAAGSGLIVFIVLWTPWLSIEDIPLVLSRIFPFNRGVFEDKVGTFWCVTSVIIKY
KQYLSIPAMSLLTALSTLIASSPFLYFTIIKRRLKNSIFYGLAGVSLSFFLFSYHVHEKT
ILVPLLPISLITIFNSPHIFQLITVISTFSLYPLLVLDHLRMPYFIFQGLFLYLSSQHIR
NLENWTEKRNFLFWYIGLALIHCLEVFDPPSTYPYLFDLIIASYSFAGFVYVWVFLFKEH
KNLSDLSSILNKINKDKTR


>SteCoe_35621(CDS)
ATGGAAACTATCTGTAAGACCCGTCTCGCAAAAGAAAAGGAAATCCTCAAACGTATGGAG
TCTAAAAACACTAAAATAACCTTAAGCCACGACGATCGTAGCGTTGAAGTTATTTTTTCA
ATCTTCAGTACCAATATCACTTACTACATAAACCTCCCAGAGCGCTATCCTTTTTTACCC
CCAATGATCACAGTAAATATCCCATCAACCATAACAAGTTTATATTCAGAATCATCCGAC
CTCCTCCCTTTAATAATCGAAGATACTTGGACACCATCAATAAACCTACAGACTTTAATC
GAAAACATAGCATTATTTAACACAAAAAGTCTTAGCCAAAACAAAGCTAGTCAAATTGGT
GGACTAAGTCTTTGGTCAATAGTTCTTATTTCTATAATCTTTAGAGTTGCAATGTATAGT
CAAAGCTATTCAGGCCATTATACACCTCCTTTATATGGGGATTATGAGGCTCAAAGGCAT
TGGATGGAATTGACTTATAATTTCCCAGCTGAAATGTGGTATAAAGATACTATAGAAACT
GATCCAGGGTATTGGAAATTAGATTATCCTCCTTTGACAGCTTGGCATTCATATTTTTGT
GGGCTTATAAGTGCAGTTTATGAACCTGAGTCTATGGAATTAGATAAATCAAGAGGATAT
TATACAGAAAGTCATCTTATGTTTATGAGAACAACAGTTTTGATTAGTGAAATTATCGTT
TATATACCTGCAGTTATTGTTTTTTTTACAGTTTTCAATATGAGTTTTCAACAGAAAATC
AGAAATATGGGTTTATTACTTTTTCTTATGTCCCCACCATTGATACTTATTGATTATGGG
CATTTTCAATATAATAATCTTATGCTAGGATTTGCCTTAGTTTCTACTCTTATGACAGTT
TATGGATATTACTCAGCAGCGGCTATATTTTTAGCTTTGGGTATCAACTTTAAAATCATG
TCTTTATATTATATTTTACCTTTAGGGATTTTATGGGTTGTTGTTGCTTGGGATCAAGGT
TTAAGAGAAAGATATAGACTTGGGGGAAATTTAAAATATATTGTTCAAAGCTTTGTAACT
ATGTCTGGGATAATTGCCGCTGCTGGCAGCGGCCTTATAGTTTTTATTGTTTTATGGACT
CCTTGGCTTAGTATTGAAGATATTCCTTTAGTTTTAAGTAGAATCTTCCCATTTAACCGA
GGGGTTTTTGAAGATAAAGTAGGAACATTTTGGTGTGTGACTTCAGTTATAATCAAATAC
AAGCAATATTTATCAATTCCCGCTATGAGCTTATTAACAGCTTTAAGTACCCTTATAGCC
TCAAGTCCATTTCTTTATTTCACAATCATAAAAAGACGATTAAAAAACAGTATTTTCTAT
GGTTTGGCAGGTGTTTCTCTATCTTTTTTCTTATTCTCTTATCATGTACATGAAAAAACT
ATATTAGTCCCATTATTACCAATATCCCTTATAACTATCTTTAACTCTCCTCATATTTTC
CAATTAATTACTGTTATAAGCACATTTAGCCTATACCCTTTATTAGTCCTTGATCATCTT
CGTATGCCTTATTTTATATTCCAAGGTCTATTTTTATATCTATCCTCACAACATATTCGT
AATTTAGAAAACTGGACTGAAAAACGCAATTTTTTATTTTGGTACATAGGATTAGCTTTA
ATTCATTGTTTAGAAGTTTTTGATCCACCTTCAACATATCCTTATCTTTTTGATTTAATT
ATTGCAAGCTACTCATTTGCTGGGTTTGTTTATGTTTGGGTGTTTTTGTTTAAAGAACAT
AAAAATCTTAGTGACCTTAGTAGTATACTCAACAAAATTAACAAAGATAAAACTAGATAA