Identifiers and Description

Gene Model Identifier

SteCoe_35703

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004540805.380186160021138e-32Homolog of yeast RPS22, bacter
ial RPS8;
Oxytricha TrifallaxContig12805.0.g1065.380186160021138e-32Ribosomal protein S8

Saccharomyces CerevisiaeYJL190C3.975449735908647e-31Protein component of the small
(40S) ribosomal subunit; homo
logous to mammalian ribosomal
protein S15A and bacterial S8;
RPS22A has a paralog, RPS22B,
that arose from the whole gen
ome duplication
WormBaseWBGene000044911.0806392777072785e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35703(Protein)
MVRMNVLADCLKSIINAEKRGKRQVLIRPCSKVVLRFLRLMQKHGYIGEFEVVDDHRSNK
IVVDLNGRLNKCGVISPRFDISLVDLDQVTTNLLPSRQFGYVVLTTTYGILDHEEARKRH
TGGKLLGFFY


>SteCoe_35703(CDS)
ATGGTGCGAATGAACGTGTTGGCAGACTGCCTCAAAAGCATTATAAACGCCGAAAAAAGA
GGCAAACGCCAAGTGCTTATTCGTCCTTGCTCAAAAGTAGTCCTTCGTTTCCTCAGATTA
ATGCAAAAACACGGGTACATTGGTGAGTTTGAAGTTGTTGACGACCATAGATCCAATAAA
ATTGTAGTAGACCTTAATGGAAGGCTTAACAAATGCGGGGTCATTTCACCAAGATTTGAT
ATTTCTTTAGTAGACCTTGATCAAGTAACCACAAACCTCCTTCCTTCAAGGCAGTTTGGA
TATGTCGTCCTAACAACTACTTATGGGATTTTAGACCATGAAGAAGCAAGAAAAAGACAT
ACAGGTGGAAAGCTTTTAGGATTCTTCTATTAA