Identifiers and Description

Gene Model Identifier

SteCoe_35833

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig186.0.1.g191.3336148155022614e-34Histone deacetylase domain

Tetrahymena ThermophilaTTHERM_010147001.462486227251231e-31Histone deacetylase family pro
tein
WormBaseWBGene000183191.185064864233981e-27
Saccharomyces CerevisiaeYNL021W3.221340285992516e-27Putative catalytic subunit of
a class II histone deacetylase
complex; role in azole resist
ance via Hsp90p, and in the he
at shock response; Hda1p inter
acts with the Hda2p-Hda3p subc
omplex to form an active tetra
mer; deletion increases histon
e H2B, H3 and H4 acetylation;
other members of the HDA1 hist
one deacetylase complex are Hd
a2p and Hda3p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35833(Protein)
MEKVGYVYDERLTLHSEEPRNTFPEFPERIRAIHRKLESQNLLPHLQNIPASSVSADFVS
TVHQPSLVERLVDLKFDYSDMMNPKPRQKGVKYTMGRQLYDNEHTSDCIFLSAGSVMNAV
DWVWSGRVHSAFANVRPPGHHASYSQIGGFCYVNNIAIAARHAQEHLGAKKIAILDWDVH
HGNGTQDIFKADPDIFYMSIHRYDNGTFYPYLKDSSSLFLGENEGKGFNVNIAWDTETPK
ELSAISDGDYKLAFDGIIDPMLDQFRPDLVLVSAGFDAMLNDPVGNLSLTPDIYAYMSYM
LKSKHKVVLALEGGYNLETMQNAAYASVRGLIRKDIDFSRYNPESTEIGRQSLANTIEVA
QDYWNVERYDLEGN


>SteCoe_35833(CDS)
ATGGAAAAAGTTGGCTACGTCTACGACGAAAGACTAACCTTACATAGCGAAGAGCCTAGG
AACACTTTCCCAGAGTTTCCAGAGCGTATTAGGGCAATCCACAGAAAACTTGAGTCCCAA
AACCTCCTTCCCCATCTTCAAAATATCCCAGCAAGTTCAGTAAGTGCTGATTTTGTAAGC
ACAGTACATCAACCAAGCTTAGTTGAAAGACTTGTTGACTTAAAATTCGATTATAGTGAC
ATGATGAACCCAAAACCAAGACAAAAAGGTGTTAAGTACACCATGGGTCGCCAGCTATAT
GATAATGAGCATACTTCAGATTGTATTTTCTTATCAGCTGGATCAGTAATGAATGCTGTT
GATTGGGTATGGTCAGGTAGGGTGCATAGTGCTTTTGCAAATGTTCGCCCACCAGGACAT
CACGCATCTTATAGTCAAATCGGGGGTTTTTGCTATGTAAACAATATTGCAATAGCAGCA
AGACATGCCCAAGAGCATTTAGGGGCTAAGAAAATCGCTATTCTAGACTGGGATGTGCAT
CACGGTAATGGTACTCAAGATATATTCAAAGCAGACCCGGATATCTTTTACATGTCTATC
CATCGTTATGATAATGGAACTTTCTACCCTTACCTCAAAGACTCCTCATCTTTGTTTCTA
GGTGAAAATGAAGGAAAAGGCTTTAATGTGAACATTGCTTGGGATACAGAAACACCTAAA
GAGCTCTCGGCGATATCAGATGGAGATTATAAACTGGCTTTTGATGGGATTATTGATCCA
ATGCTAGACCAATTTAGACCTGATTTAGTTTTAGTATCAGCTGGCTTTGATGCTATGCTA
AATGACCCTGTTGGCAACTTATCTTTAACCCCTGATATTTATGCTTATATGAGTTATATG
CTCAAATCAAAACATAAGGTTGTCCTTGCTTTAGAAGGTGGGTATAATTTGGAGACCATG
CAAAATGCGGCTTATGCCAGTGTTAGAGGATTAATAAGAAAAGATATTGACTTTTCTAGG
TATAATCCAGAGAGTACAGAGATTGGAAGGCAGTCTTTGGCTAATACTATTGAAGTTGCC
CAAGATTATTGGAATGTGGAAAGGTACGATTTAGAAGGAAATTAG