Identifiers and Description

Gene Model Identifier

SteCoe_35837

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene002351029.854154686111257e-34
Oxytricha TrifallaxContig13930.0.g342.6786369618080778e-33Mitosis protein DIM1

Tetrahymena ThermophilaTTHERM_007942801.462486227251231e-31Mitosis protein DIM1 containin
g protein
Saccharomyces CerevisiaeYPR082C8.75651076269652e-2717-kDa component of the U4/U6a
U5 tri-snRNP; plays an essenti
al role in pre-mRNA splicing,
orthologue of hDIM1, the human
U5-specific 15-kDa protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35837(Protein)
MSYLLPHLHDGWEVDQAILSEKDKVVIIRFGHDGDRTCMKMDEMLFQIAYPIMNFARIYL
VDISEVPDFNNMYELFDPCNVMFFYRNKHIMVDFGTGNNYKLNFLLPDKQELIDIVECVY
RAAVKGRGLAVSPFDYSTKYRY


>SteCoe_35837(CDS)
ATGTCTTACTTGCTACCTCATCTTCACGACGGGTGGGAAGTTGATCAAGCAATTCTTTCG
GAAAAAGATAAAGTTGTTATTATAAGATTTGGACATGATGGGGATAGAACCTGTATGAAA
ATGGATGAAATGCTCTTTCAAATTGCTTACCCGATTATGAACTTCGCCAGAATTTACTTA
GTAGATATATCAGAAGTCCCAGATTTCAATAACATGTACGAGCTTTTTGACCCATGCAAT
GTGATGTTTTTTTATAGAAATAAACATATTATGGTTGACTTCGGCACAGGGAACAATTAT
AAATTGAATTTTTTACTCCCTGATAAGCAAGAATTAATAGATATTGTTGAGTGTGTTTAT
AGAGCTGCTGTTAAAGGTAGGGGTCTTGCAGTAAGTCCATTTGATTATTCGACTAAATAT
AGATACTAA