Identifiers and Description

Gene Model Identifier

SteCoe_35880

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002183801.0112214926104486e-43Ubiquitin-conjugating enzyme f
amily protein
WormBaseWBGene000023442.1151310375910805e-19
Saccharomyces CerevisiaeYBR082C5.74952226429356e-19Ubiquitin-conjugating enzyme (
E2); key E2 partner with Ubc1p
for the anaphase-promoting co
mplex (APC); mediates degradat
ion of abnormal or excess prot
eins, including calmodulin and
histone H3; regulates levels
of DNA Polymerase-{alpha} to p
romote efficient and accurate
DNA replication; interacts wit
h many SCF ubiquitin protein l
igases; component of the cellu
lar stress response; UBC4 has
a paralog, UBC5, that arose fr
om the whole genome duplicatio
n
Oxytricha TrifallaxContig13807.0.g1101.1548224173015786e-17Ubiquitin-conjugating enzyme

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35880(Protein)
MLSEYQLASSQKIIYEKINPEYSTFSYKHHNKQSIQQSNDGIRFLHSFLHTFGKLIEISE
KPIRESLLGYVRQFTYNCTPYLSALYRLSKGKNLSVLSSVALEEGTLILVRTVTKDIFKE
NIEGDKLFEHAIDVYGLLCDLSCNQSEELSRDEVYKEFDIVCQLSQQTLKEPVLIKRTDM
KVMYYEKEELVKKFKADEEVKFVIKMKPEELKVDENFKIIIKRSLLNGYDTVYLWEGIYD
TTKTIGQLVAEKYPQGINITKAQDLKRAYKITKPVPPLSLKSTDNRDCMTYNKSKELVVS
LGPSNKEPNKVDLMNILTRAVQMIDIDDLASAIEMRNPTQVGQEVITRNPDEAIVVVFDV
SGSMGTRFFDDQDFTRLDATKEFFETFTDRTAGFDFSHVISLLLFSTSFTRACGFTENVV
TFSSHIQNAQAGGGTKLWDALSMAIDYLKEFKNTYPNAHLRILCLSDGEDTSSSNNYVTI
SKSLVSYNITMDSIVVGALSQQLKAASFASGGYVFMPKNIPDGVNLFQAETFISFRARTV
PSRTLVNTEADLIPLLSKEPTNSQPISAALPQEISAKSASMKATIAKLASNPPLPAAKGV
SGGSIGGAGLKRITKELQELESNPHPSFTVYPTENDVTFWNVYMNGPETTPYEGGVFQLY
VKLPNDYPFKPPNLKFITRIYHCNINSNGSICHAILKDQWSPALTLRKVFDCIYGLLLTP
EPLDPLDPQIATEYRVDYDLFFQKAVDFTKKYATVDVPQSSDHDKTIPPPQFLCGITGNL
MTDPVMVVKSNNSYERSEIERIIDSTGKEPKTGEDITRADLVTNVALMLAIQEFNKMNAS
GP


>SteCoe_35880(CDS)
ATGCTTTCTGAATATCAACTTGCTAGCAGCCAGAAAATTATATATGAAAAAATTAACCCA
GAATATTCAACTTTTTCCTATAAGCATCATAACAAGCAATCAATACAACAAAGCAACGAT
GGGATTCGGTTTTTGCATAGCTTCTTGCATACATTCGGCAAACTTATAGAAATAAGCGAG
AAACCTATACGTGAATCTTTACTTGGCTATGTAAGACAATTTACTTATAATTGTACTCCT
TACCTTTCAGCGCTATATCGTTTGAGTAAAGGGAAAAATCTCAGTGTTTTGAGCTCAGTT
GCTTTAGAAGAAGGGACATTGATTCTGGTCCGGACTGTGACTAAGGATATTTTCAAAGAA
AATATTGAAGGGGATAAGCTTTTTGAGCATGCTATTGATGTTTATGGACTATTATGTGAT
CTTAGTTGTAATCAAAGTGAAGAATTGAGTAGAGATGAGGTTTATAAGGAATTTGATATT
GTGTGCCAGCTAAGTCAGCAGACATTAAAGGAGCCAGTGCTTATTAAAAGGACTGATATG
AAAGTGATGTATTATGAAAAAGAAGAACTTGTTAAGAAATTTAAGGCTGATGAGGAAGTG
AAATTTGTCATTAAGATGAAACCAGAAGAGTTAAAAGTTGATGAGAACTTTAAGATCATA
ATCAAAAGAAGTCTTCTTAATGGATATGATACTGTGTATTTATGGGAAGGTATCTACGAT
ACAACCAAGACAATCGGCCAACTAGTTGCAGAAAAGTACCCTCAAGGCATAAATATTACC
AAAGCCCAAGATCTCAAAAGAGCCTACAAAATCACTAAGCCCGTCCCTCCACTTTCTCTA
AAATCAACTGACAATCGTGACTGCATGACTTACAATAAAAGCAAGGAACTTGTAGTTTCC
TTAGGCCCATCCAACAAAGAGCCAAACAAAGTTGATCTCATGAACATACTTACAAGAGCA
GTTCAAATGATTGATATCGACGACCTTGCAAGCGCAATAGAAATGCGTAACCCAACTCAA
GTAGGTCAAGAAGTTATAACAAGAAACCCAGATGAAGCTATTGTTGTTGTCTTTGATGTC
AGTGGCTCAATGGGAACTAGGTTTTTTGACGACCAAGATTTCACAAGACTTGATGCAACT
AAAGAGTTTTTTGAAACTTTCACTGATAGAACAGCAGGTTTTGATTTTAGCCACGTCATA
TCCTTATTGTTATTTAGTACAAGCTTTACTCGTGCATGTGGGTTTACAGAAAATGTTGTA
ACCTTTTCTTCACATATTCAAAATGCTCAAGCTGGAGGTGGGACCAAGCTTTGGGATGCT
TTGAGTATGGCTATTGATTATTTGAAAGAATTTAAAAATACATATCCAAATGCGCATTTG
AGGATATTATGCCTAAGTGATGGTGAAGATACTAGTTCATCAAATAACTATGTTACTATT
TCCAAATCTTTGGTTTCTTATAATATTACTATGGATAGTATTGTAGTTGGGGCACTTTCT
CAACAATTGAAAGCTGCATCATTTGCTTCTGGAGGGTATGTGTTTATGCCTAAGAATATA
CCTGATGGAGTTAATTTATTCCAGGCTGAAACTTTCATTTCATTTAGAGCGAGGACTGTG
CCAAGCCGTACTCTTGTCAATACTGAGGCTGATTTAATCCCATTGTTATCAAAGGAGCCA
ACTAACTCTCAACCTATTTCTGCAGCTTTACCTCAAGAAATATCGGCTAAGTCTGCATCA
ATGAAAGCAACAATAGCTAAACTTGCTAGCAATCCTCCTCTTCCAGCTGCTAAAGGTGTA
TCAGGGGGATCAATTGGAGGTGCAGGGCTAAAAAGAATAACAAAAGAGCTTCAAGAACTT
GAATCTAATCCTCATCCAAGTTTCACTGTATATCCAACAGAAAATGATGTGACATTCTGG
AACGTGTATATGAACGGCCCAGAAACAACTCCTTATGAAGGTGGCGTTTTTCAACTTTAT
GTAAAACTTCCTAATGATTATCCATTCAAACCTCCTAATTTGAAATTCATCACTCGGATT
TATCATTGCAATATAAATTCAAATGGAAGTATTTGCCATGCTATATTAAAAGATCAATGG
AGCCCTGCTTTGACCTTACGTAAAGTTTTCGATTGCATTTATGGACTTTTACTTACACCT
GAACCTCTTGATCCTCTAGACCCTCAAATTGCCACAGAATATAGAGTTGATTATGATTTG
TTTTTCCAAAAAGCTGTTGATTTTACTAAAAAATACGCTACGGTAGACGTTCCTCAAAGC
AGTGACCATGATAAAACAATTCCTCCTCCTCAATTTTTGTGTGGGATTACTGGGAATTTA
ATGACTGATCCTGTTATGGTTGTAAAGAGCAATAATTCTTATGAAAGATCTGAGATTGAA
AGAATTATAGATAGCACAGGAAAAGAGCCGAAGACTGGTGAAGATATCACTAGGGCTGAT
TTAGTGACTAATGTTGCTTTAATGCTTGCAATTCAGGAATTTAATAAGATGAATGCTTCA
GGACCTTAG