Identifiers and Description

Gene Model Identifier

SteCoe_35967

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22582.0.g1042.031092662734811e-42Structure-specific recognition
protein (SSRP1)

Saccharomyces CerevisiaeYML069W1.8048513878454153e-35Subunit of the heterodimeric F
ACT complex (Spt16p-Pob3p); FA
CT associates with chromatin v
ia interaction with Nhp6Ap and
Nhp6Bp, and reorganizes nucle
osomes to facilitate access to
DNA by RNA and DNA polymerase
s; protein abundance increases
in response to DNA replicatio
n stress
Tetrahymena ThermophilaTTHERM_000490805.380186160021138e-32Structure-specific recognition
protein
WormBaseWBGene000019745.900090541597061e-29

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_35967(Protein)
MANLSAKGWSWGEYQLNENQLQFLVDKKPCFNINYKDIINCSVPGKNEIAFEFQQNEATE
DDILCEMRVYLPEADSCDALTKEISERSEFRASSVDALVTLYDLPMIVPRGKYSLDMFQN
FMRLHGKTHNYKIMYKNVTKAFLLPKPDGIHIAMVIGLDTPIRQGNTVYPFVVMQFSKDS
QESVTFNMPAEEIKRNFGDELTQTIEGKSFDVMSKLLKAMVKTMIIVPGNFKSKNDTNAI
KCSVKASEGHLYPLQKSFIFISKPVIYIKFEDIRYIEFARISDESMATNRSFDLNVCTKN
GSFQFTGVDREEYQIMLEFLQKKKIQVRNVEEEPKEADSSDDNMDVDEDEEDEEDDSFNA
SDLD


>SteCoe_35967(CDS)
ATGGCAAATCTTAGCGCTAAAGGTTGGAGCTGGGGGGAATATCAATTAAACGAAAACCAG
CTCCAATTTCTCGTAGATAAAAAGCCATGCTTCAACATCAACTACAAAGACATAATCAAC
TGTTCAGTGCCTGGGAAAAATGAAATTGCCTTTGAGTTCCAACAAAATGAGGCGACCGAG
GATGATATTTTATGTGAAATGAGAGTCTACCTCCCTGAAGCCGATTCTTGTGATGCTTTG
ACAAAAGAAATTTCTGAAAGGTCTGAGTTCAGAGCTTCATCAGTAGATGCTTTAGTTACT
TTATATGATCTTCCTATGATAGTTCCTCGTGGTAAATACTCTTTGGATATGTTTCAAAAT
TTTATGAGACTTCATGGTAAGACTCACAATTACAAAATCATGTATAAAAACGTAACTAAA
GCCTTTTTATTACCAAAACCTGATGGGATTCACATTGCTATGGTTATTGGTTTAGATACT
CCTATAAGACAAGGAAATACCGTTTATCCTTTTGTAGTTATGCAATTTAGTAAAGATTCA
CAAGAAAGTGTTACATTTAATATGCCTGCTGAAGAAATTAAAAGGAACTTTGGCGATGAG
CTTACTCAAACTATTGAAGGGAAAAGTTTTGATGTTATGTCTAAATTACTTAAAGCTATG
GTTAAAACAATGATTATTGTCCCTGGGAATTTTAAGAGCAAAAATGATACTAATGCTATA
AAATGCTCGGTAAAAGCTAGTGAAGGGCATTTGTATCCTTTACAAAAAAGCTTTATTTTT
ATTAGTAAACCTGTGATTTATATTAAATTTGAAGACATTAGGTATATTGAGTTTGCAAGA
ATTAGTGATGAAAGCATGGCGACAAATAGGTCATTTGATTTGAATGTTTGTACGAAAAAT
GGGAGTTTTCAGTTTACTGGAGTAGATCGTGAGGAGTATCAAATTATGTTGGAGTTTTTA
CAGAAAAAGAAAATACAGGTTAGAAATGTGGAAGAAGAACCTAAGGAAGCTGATAGTTCT
GATGATAATATGGATGTAGATGAAGATGAAGAAGATGAGGAAGATGATAGTTTTAATGCT
TCAGATTTAGATTAA