Identifiers and Description

Gene Model Identifier

SteCoe_36242

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000471101.462486227251231e-31UDP-glucose:dolichyl-phosphate
glucosyltransferase
WormBaseWBGene000192762.1705220113036395e-29
Oxytricha TrifallaxContig14645.0.g353.532628572200807e-24Glycosyl transferase family 2

Saccharomyces CerevisiaeYPL227C3.873997628687187e-21UDP-glucose:dolichyl-phosphate
glucosyltransferase; involved
in asparagine-linked glycosyl
ation in the endoplasmic retic
ulum

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36242(Protein)
MLYWICTIIALLILFFYWFTIPYRSLRSHISHKPNIRLIETNGQSQSLFQNDEVTLKISQ
PATLAFSLIVPAYNEEKRISQMLQSYIIYLNSRKFNYEVIVVDDGSTDKTTEVALRTGKE
MNCNLKVIKCEENGGKGLAVKIGMLNSVGEKCLFADADGATKIESFPEMENELENITRKG
LGVVVGSRNHNKLNVTRQRSKFRDMISKTCTFGMKILFHTELKDTQCGFKLFTRLAAQRL
FMIQHLERWAFDLELIFLCSKMHIPISEVPVHWTEIPGSKFNVLKDLITMARDVSLVRIL
YMITVWKLTDTMIPGLGAQN


>SteCoe_36242(CDS)
ATGCTGTACTGGATCTGCACCATCATAGCTTTACTGATTTTATTCTTCTACTGGTTTACT
ATTCCTTACAGAAGTCTAAGATCGCATATTTCCCACAAGCCGAACATCCGCTTAATCGAA
ACAAATGGTCAAAGCCAGTCATTATTCCAAAATGATGAAGTTACATTAAAAATATCTCAA
CCAGCCACATTAGCTTTTTCTCTAATTGTCCCAGCTTACAACGAAGAAAAGCGTATTAGT
CAAATGCTTCAAAGCTATATCATCTATCTCAATTCTCGTAAATTTAATTACGAAGTCATT
GTAGTCGATGATGGTAGTACTGATAAAACTACCGAAGTAGCTCTAAGAACCGGTAAAGAA
ATGAACTGCAACTTAAAAGTAATAAAATGTGAAGAAAATGGGGGAAAAGGACTTGCGGTA
AAGATCGGGATGTTGAATTCTGTTGGAGAAAAGTGTCTTTTTGCAGATGCAGATGGGGCA
ACAAAAATTGAAAGTTTTCCTGAAATGGAAAATGAACTAGAAAACATTACAAGAAAAGGT
TTAGGTGTAGTTGTTGGATCAAGAAATCATAATAAACTTAATGTTACAAGACAACGAAGC
AAATTCAGAGATATGATAAGTAAAACTTGTACTTTTGGTATGAAAATCTTATTCCATACA
GAACTTAAAGATACACAATGTGGGTTTAAGCTTTTTACTCGACTTGCAGCACAGAGACTT
TTTATGATACAACATTTAGAAAGATGGGCTTTTGATTTAGAACTCATTTTCCTTTGTAGT
AAAATGCATATTCCAATATCAGAAGTTCCTGTGCATTGGACTGAAATCCCTGGAAGTAAG
TTTAATGTCCTTAAAGACCTTATTACTATGGCTAGAGATGTCTCACTTGTCAGAATCCTT
TATATGATTACAGTATGGAAACTTACTGATACTATGATCCCTGGCTTGGGTGCTCAGAAT
TAG