Identifiers and Description

Gene Model Identifier

SteCoe_36355

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig11604.0.g354.961148436415422e-78Adaptin N terminal region

Tetrahymena ThermophilaTTHERM_007157502.001470128041443e-75AP-1 adaptor complex, gamma su
bunit
WormBaseWBGene000001582.970445045520691e-73
Saccharomyces CerevisiaeYPR029C9.854154686111257e-34Gamma-adaptin; large subunit o
f the clathrin-associated prot
ein (AP-1) complex; binds clat
hrin; involved in vesicle medi
ated transport

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36355(Protein)
MQGSKKEPTRLRDLIKSVRACKTAAEERVVIANESAEIRESFRDEAYKCRHRSVAKLLFI
QMMGYPTQFGQVECLKLIASNNFTEKRVGYLGLAQLLNEQDDVLLMVTNIMQIDMNSPNN
QISGMGITSMANVATAEMCRDLCKDVCKLMNHSNSYIRKKAALAGVRIARKCPDMVDDLA
NEIPRLIEDRSHVVVMNGVNLLLEVLKVNPGLRSKFMQFTSLIVKAMRNLLHSVHSPEHS
IGGVTDPFLQVRLLRLLCKLTNAQPSEETCDCLAQVSTNTDSGKNAGNAVLYECVKTILE
VQSTSGLRVLATNIMGRFLMSRDNNLRYVALNSLLRLVKIDPLAVQRHKTTIMDCLKDPD
LAIKKKALDLTSVLINESNVKQIVKELIDHLISSEPELKEAIVAKLCGALEEHSSSKQWT
IDTLTQILSIAGSYVDDDVISSTAHIISSTAELQAYSVHKLYRALKDNIDQQGLVLLSVW
CLGEYGDLITKSRVVFPDITYNPVPANEICSMFEKILISPCSDFCKEYVLTSAAKLSVKA
SESKESFKRLLSLQAASLNLELQQRACEYLALLETSWDHIRGPLFERMPVFNKYANDAPA
TETPKVEKTEEVWLMDLLGDSGVSGPLMQAPPSNPVLTNQGSSSLNLLGGLDFTPVQPAP
VYQQNLIEKSQSLSPTKTPLPDLLSDFYNPEPEFQDFQSATPTQMAIIAYEDTEICITFN
LNKGDTPAETIINTVSKSKISAEIRDFKLFSAVQKHLIMSILPASGSYMAPGESITQQIK
IVNTVQGVKPIVIRLKIDYIAFGSPRSRIATVDSIPNDY


>SteCoe_36355(CDS)
ATGCAGGGGTCGAAAAAGGAGCCAACCCGTCTCCGGGACTTGATCAAATCTGTGCGAGCC
TGTAAAACCGCTGCCGAAGAGCGTGTCGTTATCGCAAACGAAAGCGCTGAAATCCGAGAA
AGTTTCAGAGACGAAGCCTATAAATGTCGACATAGAAGCGTGGCTAAGCTTCTCTTCATC
CAAATGATGGGTTATCCAACTCAATTTGGCCAAGTTGAATGCTTAAAACTCATAGCTTCC
AACAATTTCACTGAAAAACGTGTCGGATATCTTGGTTTAGCCCAGCTTCTAAATGAACAA
GATGATGTTTTATTAATGGTCACTAACATAATGCAAATTGACATGAACTCACCAAACAAT
CAAATTTCAGGAATGGGCATAACATCAATGGCTAATGTGGCAACAGCAGAAATGTGCCGA
GATTTATGTAAAGATGTATGTAAACTTATGAACCATTCTAATAGCTATATAAGAAAAAAA
GCAGCTTTAGCTGGAGTTCGTATAGCTAGAAAATGTCCAGATATGGTTGATGATTTAGCT
AATGAGATTCCTAGATTGATTGAAGATAGAAGCCATGTTGTTGTAATGAATGGAGTCAAT
TTGTTATTAGAAGTCCTTAAAGTCAACCCAGGATTAAGGTCGAAATTCATGCAGTTTACG
TCGCTTATAGTAAAAGCAATGAGGAATTTGTTACATTCAGTTCATTCTCCTGAGCATAGT
ATTGGAGGAGTTACTGACCCTTTTCTCCAAGTACGATTATTAAGACTTTTATGCAAACTA
ACTAATGCACAACCATCTGAAGAAACTTGTGACTGCTTAGCTCAAGTATCAACAAATACA
GACTCAGGGAAAAATGCAGGTAATGCTGTGTTATATGAATGTGTTAAAACCATATTAGAA
GTGCAGTCAACTAGTGGACTAAGGGTTTTAGCAACTAACATTATGGGTCGGTTTCTAATG
AGCCGCGATAACAACTTAAGATATGTTGCCCTTAACTCCTTATTACGCCTTGTGAAAATC
GATCCACTTGCTGTACAGCGACATAAAACCACTATAATGGACTGTTTAAAAGACCCAGAT
CTAGCTATTAAAAAAAAAGCTCTCGACCTCACTTCTGTTCTAATCAATGAAAGTAATGTA
AAACAAATAGTCAAAGAACTCATCGACCATCTTATATCTTCAGAACCTGAACTCAAAGAA
GCTATTGTGGCAAAATTATGTGGAGCTCTTGAAGAACATAGTTCAAGTAAACAATGGACT
ATTGATACTCTTACACAAATTTTATCTATAGCTGGAAGTTATGTTGATGATGATGTTATT
TCTTCAACTGCTCATATTATATCATCAACTGCTGAACTTCAAGCATATTCAGTTCATAAA
TTATATAGAGCGTTAAAAGATAATATAGATCAACAAGGTTTGGTTTTATTAAGTGTATGG
TGTTTAGGAGAATATGGGGATTTAATAACAAAAAGTCGAGTTGTTTTCCCTGATATAACT
TATAATCCTGTCCCAGCTAATGAAATATGCAGCATGTTTGAAAAAATCCTCATCTCACCT
TGTAGTGATTTTTGTAAAGAATATGTTCTAACCAGTGCTGCAAAGCTTTCAGTAAAAGCT
TCAGAGTCTAAAGAAAGCTTTAAGAGGTTGTTATCTTTACAAGCAGCTTCACTTAATTTG
GAACTTCAACAAAGAGCTTGTGAGTATTTAGCTTTATTAGAAACCTCATGGGATCATATA
AGAGGACCACTTTTTGAACGTATGCCTGTGTTTAATAAATATGCTAATGATGCTCCAGCA
ACTGAAACTCCAAAAGTTGAAAAGACTGAAGAAGTTTGGCTTATGGACCTCCTTGGGGAT
TCTGGGGTTTCAGGACCTTTAATGCAAGCTCCACCTTCAAATCCTGTTCTAACAAATCAA
GGCTCTTCGTCTTTAAATTTGCTTGGAGGTTTAGATTTCACCCCAGTTCAACCAGCTCCT
GTTTATCAGCAAAATCTTATAGAAAAATCTCAAAGTTTATCACCTACTAAAACACCATTA
CCAGATTTATTATCAGATTTCTATAATCCAGAACCTGAGTTTCAAGACTTTCAAAGTGCA
ACACCTACACAAATGGCTATTATTGCATATGAAGATACGGAAATCTGCATAACTTTTAAT
CTTAATAAAGGAGATACACCTGCAGAAACTATTATAAATACTGTTAGTAAAAGCAAAATC
TCTGCTGAAATCAGGGATTTCAAATTGTTTTCAGCTGTTCAAAAACATCTTATTATGAGT
ATTTTACCTGCATCAGGAAGTTATATGGCTCCTGGAGAATCTATTACCCAACAGATCAAG
ATTGTTAATACTGTTCAAGGGGTAAAACCTATTGTTATTAGACTGAAAATCGACTATATT
GCTTTTGGAAGCCCAAGATCAAGAATTGCTACAGTCGATAGTATTCCAAATGATTATTAG