Identifiers and Description

Gene Model Identifier

SteCoe_36399

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig6366.0.g392.6102790696677047e-23Ankyrin repeats (3 copies)

Tetrahymena ThermophilaTTHERM_012053501.0530617357553812e-203'-5' exonuclease family prote
in; identified by homology wit
h AXE1
Saccharomyces CerevisiaeYOR001W6.305116760146989e-16Nuclear exosome exonuclease co
mponent; has 3'-5' exonuclease
activity that is regulated by
Lrp1p; involved in RNA proces
sing, maturation, surveillance
, degradation, tethering, and
export; role in sn/snoRNAs pre
cursor degradation; forms a st
able heterodimer with Lrp1p; h
as similarity to E. coli RNase
D and to human PM-Sc1 100 (EX
OSC10); mutant displays reduce
d transcription elongation in
the G-less-based
WormBaseWBGene000007966.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36399(Protein)
MEWFTAVKSNHFKNQSPSGFWAKVADSIDPSNPTIHYTIINDHLQNKTFLQGHQLTIEDL
YLASKLMQCPAWCKVLPCKTRPFHLTRWFMYIISAFPNINYKIHEKAKKIIKKDHRLVTA
IKQENMELFINLLDKVDINAQSPSDGGARPXNINYKIHEKAKKIIKKDHRLVTAIKQENM
ELFINLLDKVDINAQSPSDGGARPLHAAAQKGNIQAIEILLQKGAHIEGQDEDGVTPIIY
SVQSKSVAVLNFFIEKKANIFHLDKQQRNIFYWAASLGNLQMLQILLQKGMDPNIKTLLG
RTPLSKSAWNGNAEVLSFLLEIPGINLEISDKHGRTALHNAVWGSIAGREGRKIGENTTD
SPECAKLLIEKGCNIEALDKSQNTPLCIACCTYSPNSVKLLLSYGANIYHRNIKGYYPYH
QALFKGHYECAEIIADFGFNVNICNDDLTPIQSCMKHNRIGSLNWLVSRGVYPQKNDIVL
SAQWATIKILEFFKNYMKFDGLEDLIIKKAPVEGGFWIIENTEVNEKMVIESIKKDKKLG
KAALDKWSGLVTINILEAMVEAKIDTNDYLDRAEPNSQILRLAIKQKNIKLALKLIQDYP
DLATDPDEISGNTALHIACSIGQTELVSKLINIVENRFNYITQANNKGMTSISLAQLHKH
YYIAEMLKDIVIQSQGSINLSQVQNLTYEETDETLTEHPYTDKTIPLGYWKSQSESKPLS
DTKYVYIDTDQGIEDLINDIGNFSVIGVDLEYHAFESNKGCICLLQISNGEVDYVIDGLL
CREKLKILVKRFMDDEKIVKVFHGCDSDLVWLKNDFDAHPVRVFDTARAYKVLNNEKQLP
SLAKIVQEYFDVVMDKTFQIAEWRIRPLPAAMIEYARIDAHFLLSIFNKQLIEMNEIQLQ
IVNAQCNHMCLKFSKNKLIKVKVSKE


>SteCoe_36399(CDS)
ATGGAGTGGTTTACTGCAGTCAAAAGCAATCACTTCAAAAACCAATCCCCTTCTGGTTTT
TGGGCCAAAGTTGCAGACAGTATAGATCCTTCTAACCCAACAATCCACTACACCATCATA
AATGACCATTTACAAAACAAAACATTTCTTCAAGGTCATCAGTTAACAATAGAAGACCTT
TACCTAGCTTCAAAACTCATGCAATGTCCAGCTTGGTGTAAAGTTCTCCCCTGTAAAACT
CGTCCATTCCATTTAACCCGTTGGTTCATGTATATTATTTCAGCATTCCCCAATATAAAC
TATAAAATTCATGAGAAAGCTAAAAAAATCATTAAAAAAGATCATCGACTTGTCACAGCC
ATAAAGCAGGAAAACATGGAACTATTCATAAATTTACTAGATAAAGTTGATATCAATGCT
CAAAGTCCTTCTGATGGAGGGGCAAGGCCACNCAATATAAACTATAAAATTCATGAGAAA
GCTAAAAAAATCATTAAAAAAGATCATCGACTTGTCACAGCCATAAAGCAGGAAAACATG
GAACTATTTATAAATTTACTAGATAAAGTTGATATCAATGCTCAAAGTCCTTCTGATGGA
GGGGCAAGGCCACTGCACGCAGCGGCTCAAAAAGGTAATATTCAAGCTATTGAAATTTTA
TTACAAAAAGGAGCCCATATAGAAGGACAAGATGAAGATGGTGTTACTCCAATAATCTAC
TCAGTTCAAAGCAAATCTGTAGCCGTGCTTAATTTTTTTATAGAAAAAAAAGCTAATATT
TTCCATCTCGACAAACAGCAAAGGAACATTTTCTATTGGGCAGCAAGTCTTGGGAATTTG
CAGATGCTTCAAATTCTGCTTCAAAAAGGTATGGATCCAAACATAAAAACACTACTTGGT
AGAACTCCATTAAGTAAAAGTGCCTGGAATGGTAATGCTGAAGTTCTGAGTTTCCTTCTT
GAAATCCCTGGAATCAACTTAGAAATCTCAGATAAGCATGGGAGGACAGCTTTACATAAT
GCGGTTTGGGGTAGTATTGCAGGTAGAGAAGGTAGGAAAATCGGTGAAAATACTACAGAT
AGTCCTGAATGTGCTAAGTTGCTTATAGAAAAAGGATGCAATATAGAAGCTTTGGATAAA
TCACAAAACACCCCTTTGTGTATAGCCTGTTGTACTTATTCCCCGAATTCTGTGAAATTG
CTATTGTCATATGGGGCAAATATTTATCATAGGAATATTAAAGGATATTACCCTTATCAT
CAAGCTCTTTTTAAAGGCCACTATGAATGTGCTGAGATTATTGCAGATTTTGGATTCAAT
GTGAATATATGCAATGATGATTTAACTCCTATACAAAGCTGTATGAAGCATAATAGGATT
GGGTCACTTAATTGGCTTGTTTCAAGAGGTGTTTATCCACAAAAAAATGATATTGTGTTA
TCAGCACAGTGGGCAACTATCAAAATCCTTGAGTTTTTTAAAAACTATATGAAATTTGAT
GGACTAGAAGACTTGATTATAAAAAAAGCTCCAGTTGAAGGAGGTTTTTGGATTATAGAA
AACACTGAAGTTAATGAGAAAATGGTTATAGAAAGTATAAAAAAAGATAAAAAACTTGGA
AAGGCAGCTTTGGATAAATGGTCTGGATTGGTTACTATAAACATCTTAGAAGCTATGGTT
GAAGCAAAAATAGATACAAATGATTATTTAGATAGAGCTGAGCCAAATAGTCAAATATTA
AGATTAGCAATAAAACAAAAAAACATAAAACTTGCTTTAAAACTCATACAAGACTATCCT
GACCTAGCAACAGATCCTGATGAGATTTCTGGAAACACAGCTTTACATATAGCATGCTCA
ATAGGACAAACTGAATTAGTATCTAAACTTATAAATATAGTTGAAAACCGATTTAACTAT
ATAACCCAAGCTAACAACAAAGGTATGACATCGATATCTTTAGCTCAATTACATAAACAT
TATTATATAGCAGAAATGCTCAAAGATATTGTCATACAAAGCCAGGGATCTATAAACCTA
AGCCAAGTGCAAAATTTAACCTATGAAGAAACTGATGAAACTCTAACTGAGCACCCTTAT
ACAGATAAAACTATACCTTTAGGATATTGGAAAAGTCAAAGTGAAAGTAAGCCTTTAAGT
GATACCAAATACGTATATATAGATACAGATCAAGGTATAGAAGATTTGATAAATGATATA
GGAAATTTTTCAGTAATTGGAGTTGATTTAGAATATCATGCTTTTGAAAGTAACAAGGGG
TGTATATGTCTTTTGCAAATATCAAATGGAGAAGTGGATTATGTTATTGATGGACTTTTA
TGTAGAGAAAAATTAAAGATTTTAGTTAAGAGGTTTATGGATGATGAAAAAATTGTTAAG
GTTTTTCATGGATGCGACTCAGACCTTGTTTGGCTTAAAAATGACTTTGATGCTCATCCT
GTGAGAGTTTTTGATACTGCAAGAGCTTATAAGGTACTTAATAATGAAAAGCAACTCCCT
TCACTTGCTAAGATTGTACAGGAATATTTTGATGTTGTTATGGATAAGACCTTTCAGATT
GCTGAGTGGAGGATTAGGCCATTGCCTGCTGCTATGATTGAGTATGCTAGAATTGATGCC
CATTTCCTTTTATCAATATTTAACAAGCAGCTAATTGAGATGAATGAGATTCAGTTACAA
ATTGTAAATGCTCAGTGCAATCATATGTGCTTAAAGTTTAGTAAAAATAAACTTATAAAA
GTTAAAGTGAGTAAAGAGTAA