Identifiers and Description

Gene Model Identifier

SteCoe_36528

Standard Name

None

Aliases

None

Description

Helicase_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16198.0.g702.138865964899539e-62Helicase conserved C-terminal
domain

Tetrahymena ThermophilaTTHERM_000881509.854154686111257e-34DExH box putative RNA helicase
Saccharomyces CerevisiaeYLR419W2.9374821117108028e-30Putative helicase with limited
sequence similarity to human
Rb protein; the authentic, non
-tagged protein is detected in
highly purified mitochondria
in high-throughput studies; YL
R419W is not an essential gene
WormBaseWBGene000033927.984904245686979e-30

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36528(Protein)
MNRPPIPTWRKAKAPMKKRKLNDSAYKANPDFCNENLPIHSRRLDIMATLATAQVLIVQG
DTGCGKTTQLPQFIYRDYPDSRIAVTQPRRLAAVGVARRVAREIGTSLGTEVGYHIRGEK
NYRDSSRIIFMTTGMFIQELVGCNKLPYTHIIIDEVHERAIETEFLLVVLKHMIYNTNFK
LILMSATINASLFANYYSDSEIERIATLPREINVVKECIQSFDAPEKSILHVSYEGDRDD
AAPIRLAGPRNFAVKEIYLEEMLEILSEDLVFTEIEMEEIQNYYKTELVSIDSHFYRIAA
HLIRFQHLMRIYEEEKPQTFLIFLPGIHEITKMGKVIAEDVMRDQIDDLEICMLHSSIPE
ESHGNIFKDPEGKRRIIISTNIAESSITLPDVRYIIDFGLTKELVFNSSTKCERLQMQWA
CKAVMQQRAGRAGRVAEGVCFRLMPEDYYKSLRDHSIPEIQRCPLDKLVLKVKQLNLGTP
ALILSRAIQPPNLNEIIATEEYLREMGALTDDNKLTWLGRVYADMPCDVKISRLCLFGYI
FNCLHECLLMGALMSQEKPIFLSFAHMDFKHSQYESYRYAKKLMWDNLRDSDPITALSAY
KAWYAAHGKNYVRNMKKSSFSHTSRQEVSMAERNWCKGSAVDYNVLREVCATFQELKRRL
KYMGLAKQHLTNRLNDSPDNILTLKLCIAAAYNEKYLTSYYGFEDEVMRRKKEHMLKERQ
GCKVIIPGIPKDVTCQDIKEILKPTRAKNIQVDMERENAIITFDPSESKRPLQMCLWLGT
FPQRYKCGEFIVAKKYLLDKNNNRIEALPIENLSQVKQRVAYSQPREGMKIEVEHSRLAD
KFVHIEAFCLQKPEYIYRLSFKDFLTGSMISLDESSVCKVALEQNAAFERCHMVVCCELV
EKRNRTVASNITLMPCLPMLPHLLTMVFTKDIKLFETDKKYGGFRAGPCEIWFNFTFSGK
DIEEINDIRKDISEALFDEKGILNPAPLKVREKLFKLIHKKRLPLIEKKFKKLITHNEEE
LNEENQCKSSLNTQESVLMQEDLSIHNSIQEEKSNSITENDSKTNSQQSNNRNANNKKEI
YLKPLERLDSVIEDARAWTEEGQKKIELEMLQLRASKEEMVLKIKNQARMSKILRPEIIC
STCKNTICAYFNASPIELTPVSGKFKLNCVFGSVRSERELPENITINQFVESICDQILDI
EEWALCMEGHLIGWKTGESYFINHQSPLELLMTDGSMIPWGSCLWRDGYEKFAEMCRIDE
KNSKYKTRNDLKLKCTICNEEFVNSGDFFNHVIVSKEHTENVTRFLRDGY


>SteCoe_36528(CDS)
ATGAATAGACCTCCTATACCAACTTGGCGCAAAGCAAAAGCACCAATGAAAAAGCGAAAA
CTCAATGACTCAGCTTATAAAGCAAACCCTGATTTCTGTAATGAGAATCTTCCAATCCAT
AGCCGCAGACTCGACATCATGGCAACATTGGCTACAGCTCAAGTTCTCATAGTTCAAGGA
GATACTGGATGCGGAAAAACAACCCAATTGCCTCAATTCATATATAGAGATTATCCTGAT
TCAAGGATTGCAGTAACACAGCCAAGAAGGCTTGCTGCTGTAGGAGTAGCTAGGAGAGTA
GCTCGTGAAATTGGAACATCATTAGGAACAGAAGTTGGATATCATATACGCGGGGAGAAA
AACTATAGAGATTCTAGTCGAATAATTTTTATGACAACTGGGATGTTCATACAGGAACTT
GTTGGGTGCAATAAACTTCCGTATACACATATTATTATTGATGAAGTCCATGAAAGAGCA
ATTGAGACTGAGTTCTTATTGGTTGTCCTAAAGCATATGATCTATAACACAAATTTTAAG
CTTATTCTTATGTCTGCAACTATAAATGCTAGTCTTTTCGCTAATTATTATTCTGACTCA
GAAATCGAAAGAATAGCTACGCTTCCTAGAGAAATCAATGTAGTCAAAGAATGCATACAG
TCTTTTGATGCACCTGAGAAATCGATACTGCATGTATCTTATGAAGGAGATCGAGATGAT
GCAGCTCCTATAAGACTAGCTGGACCACGTAATTTTGCTGTCAAAGAAATCTATTTGGAA
GAGATGCTTGAGATTCTCAGCGAAGACTTGGTTTTTACAGAAATTGAAATGGAAGAAATT
CAAAATTATTACAAAACAGAGCTGGTATCAATTGACAGTCACTTCTACCGTATAGCTGCT
CATTTAATTCGTTTTCAGCATCTTATGCGTATATACGAAGAGGAAAAGCCTCAAACATTT
TTGATTTTTCTTCCAGGTATTCATGAAATTACAAAAATGGGCAAAGTTATAGCGGAAGAC
GTTATGCGTGATCAAATTGACGACCTTGAAATATGTATGCTTCATTCTTCAATCCCTGAA
GAAAGCCATGGAAACATATTCAAAGACCCAGAAGGAAAAAGGAGAATCATAATATCAACC
AACATAGCTGAAAGCTCTATAACATTGCCTGATGTAAGATATATTATTGACTTTGGTTTA
ACAAAAGAACTAGTTTTTAACTCTTCAACAAAATGTGAAAGGCTTCAAATGCAATGGGCA
TGCAAAGCTGTGATGCAACAAAGAGCAGGTAGGGCTGGAAGAGTGGCAGAAGGAGTTTGT
TTTCGCCTAATGCCTGAAGATTACTATAAGTCTTTAAGAGATCATAGTATTCCAGAAATC
CAAAGATGCCCTTTAGATAAGCTTGTGCTTAAAGTAAAACAATTAAATTTGGGAACACCA
GCTTTGATACTTAGTAGGGCGATTCAACCTCCTAATCTTAATGAGATTATAGCAACAGAA
GAGTATCTTAGGGAAATGGGTGCATTAACTGATGATAATAAGCTGACTTGGCTTGGTCGA
GTTTATGCAGATATGCCTTGTGATGTTAAAATATCTAGACTTTGTCTTTTTGGGTACATT
TTTAACTGTTTACATGAATGCTTGCTTATGGGTGCATTAATGTCACAGGAAAAGCCTATC
TTTCTATCTTTTGCTCATATGGATTTTAAGCATTCACAATACGAATCTTATAGATATGCA
AAAAAGCTAATGTGGGACAATTTAAGAGACTCAGACCCAATAACAGCTCTATCAGCTTAT
AAAGCTTGGTATGCGGCACATGGAAAAAATTATGTCAGGAATATGAAAAAAAGTTCATTT
TCACATACAAGTAGACAAGAAGTATCAATGGCCGAAAGAAACTGGTGTAAAGGAAGTGCT
GTCGATTACAACGTTTTAAGGGAAGTATGTGCTACATTTCAAGAACTCAAACGTCGGCTT
AAATATATGGGTCTAGCTAAACAACATTTAACTAATCGACTTAATGATAGCCCAGATAAT
ATCCTTACACTAAAACTCTGCATTGCTGCAGCTTACAATGAAAAATATTTAACATCTTAC
TATGGCTTTGAAGATGAAGTTATGAGAAGAAAAAAAGAGCATATGCTTAAAGAAAGGCAA
GGATGCAAAGTTATAATACCTGGCATACCAAAAGATGTCACGTGTCAAGATATTAAAGAA
ATCCTCAAACCGACAAGAGCTAAGAATATTCAGGTTGATATGGAAAGAGAAAATGCGATT
ATAACTTTTGACCCATCAGAATCCAAAAGACCATTGCAAATGTGCCTCTGGCTTGGAACA
TTCCCACAACGTTACAAATGTGGAGAGTTTATAGTTGCTAAAAAATACTTACTAGATAAA
AACAATAACAGAATTGAGGCTTTACCAATTGAAAACCTTTCTCAGGTAAAGCAAAGAGTT
GCATATTCTCAACCACGAGAAGGGATGAAAATAGAAGTTGAGCATAGTCGTTTAGCTGAT
AAATTTGTACATATTGAAGCTTTTTGTCTTCAAAAACCTGAGTATATATACAGATTAAGT
TTTAAAGATTTCTTAACAGGATCAATGATTAGTCTGGATGAATCTTCTGTATGTAAAGTT
GCCCTTGAGCAAAATGCAGCTTTTGAAAGATGTCATATGGTTGTTTGCTGTGAACTTGTT
GAAAAAAGAAATAGAACAGTTGCTTCGAATATTACGCTTATGCCTTGTTTACCTATGCTT
CCGCATTTATTAACAATGGTGTTTACTAAAGATATTAAATTGTTTGAGACTGATAAGAAA
TATGGAGGGTTTAGAGCTGGGCCATGCGAAATTTGGTTTAATTTTACGTTTTCGGGAAAA
GATATTGAAGAAATTAATGATATAAGAAAGGATATATCAGAAGCTTTGTTTGATGAGAAA
GGTATTTTAAATCCTGCTCCGCTTAAAGTCCGAGAAAAACTTTTTAAGCTTATTCATAAA
AAAAGGCTTCCACTTATAGAAAAAAAATTCAAAAAATTGATTACTCACAATGAAGAAGAA
TTAAATGAAGAAAATCAATGTAAAAGTTCTTTAAATACACAAGAAAGTGTTTTAATGCAA
GAAGACTTAAGCATTCATAATAGCATTCAAGAAGAAAAAAGCAATAGCATAACAGAAAAT
GATAGCAAAACTAATAGCCAGCAATCCAATAATCGAAATGCAAACAATAAAAAAGAAATT
TACCTAAAACCTTTAGAAAGACTAGATAGTGTTATTGAAGATGCAAGAGCTTGGACAGAA
GAAGGACAGAAAAAAATCGAGCTAGAAATGCTTCAACTCAGAGCATCAAAAGAAGAAATG
GTTCTTAAAATCAAAAATCAGGCTCGTATGTCAAAAATACTCCGTCCAGAAATAATATGT
TCAACATGTAAAAATACAATTTGCGCATATTTTAATGCAAGTCCTATAGAGCTAACTCCA
GTATCTGGTAAGTTTAAATTAAATTGTGTATTTGGCTCAGTGCGCAGTGAGAGAGAGTTA
CCTGAAAATATAACCATAAATCAATTCGTGGAAAGCATTTGCGATCAAATTTTAGACATA
GAAGAGTGGGCTTTATGTATGGAAGGCCATTTGATAGGCTGGAAAACAGGAGAATCATAT
TTTATAAATCATCAATCCCCACTTGAATTGCTTATGACTGATGGGTCTATGATTCCTTGG
GGCAGTTGCTTATGGAGAGATGGATATGAAAAATTTGCTGAAATGTGTAGAATAGATGAA
AAAAACTCAAAATATAAAACTAGAAATGATTTGAAACTTAAGTGCACAATTTGCAATGAA
GAATTCGTTAATTCAGGCGACTTTTTTAACCATGTCATTGTTAGCAAGGAGCATACAGAA
AATGTTACAAGATTTTTGCGTGATGGATATTAA