Identifiers and Description

Gene Model Identifier

SteCoe_36642

Standard Name

None

Aliases

None

Description

MAPK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig8762.0.g225.166420632837861e-55Protein kinase domain

Tetrahymena ThermophilaTTHERM_006601301.1379798735078682e-50Protein kinase domain containi
ng protein. Sequence similarit
y to the MAPK protein kinase f
amily (Eisen et al., 2006). ;P
utative mitogen-activated ERK1
/2 subfamily (MAP) kinase.

WormBaseWBGene000034011.8521167695179754e-45
Saccharomyces CerevisiaeYHR030C2.031092662734811e-42Serine/threonine MAP kinase; i
nvolved in regulating maintena
nce of cell wall integrity, ce
ll cycle progression, and nucl
ear mRNA retention in heat sho
ck; required for mitophagy and
pexophagy; affects recruitmen
t of mitochondria to phagophor
e assembly site (PAS); plays a
role in adaptive response of
cells to cold; regulated by th
e PKC1-mediated signaling path
way; SLT2 has a paralog, KDX1,
that arose from the whole gen
ome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36642(Protein)
MKDSQRDTTQEILLSFKIGPRYEAQKIIGYGAYGIVIQAKDLERDQLVAIKKLNKIEDVV
DIKRNLREIKCMRTLKHESILSIKKLIHIQENPKEIGEIYLITELMETDLHRILKSDQEL
TPDHGLYFVYYILRALKYIHSANIVHRDIKPSNILVNADCTIKICDFGLSRLIDSGLEDL
TEYVVTRFYRAPEIMLSSHMYTKSVDIWSAGCTFAEILGRKVLFPGGNYIKQIDLIIKLL
GTPSEDDMEFIANSHAKRFLQSLPYHPRQNLREFIAPNASPEAYDLMEKMLEFNPKKRIT
VEEALRHPYLADFHDSDDEPVSSETADFQFENQEFTFDELKTLLLEELEICKTLDN


>SteCoe_36642(CDS)
ATGAAAGACAGCCAAAGGGACACAACACAGGAAATCCTACTCTCCTTCAAAATCGGACCA
AGATACGAAGCTCAAAAAATCATTGGCTACGGAGCTTATGGTATAGTAATTCAAGCAAAA
GACCTTGAACGAGACCAGCTCGTAGCAATCAAGAAACTCAACAAAATCGAAGACGTGGTC
GACATTAAGCGTAACCTCAGAGAAATAAAATGTATGCGTACCTTAAAACACGAAAGCATC
TTATCAATAAAAAAACTTATCCACATCCAAGAAAACCCAAAAGAAATCGGGGAGATTTAT
TTGATTACTGAGCTTATGGAAACAGACCTTCATCGAATATTAAAATCTGATCAAGAACTT
ACCCCAGATCATGGTTTATATTTCGTATACTACATTTTACGTGCTTTAAAATATATCCAT
TCAGCAAATATAGTCCATAGGGATATAAAACCAAGTAATATTCTTGTAAACGCAGATTGT
ACTATAAAAATCTGCGACTTTGGGTTAAGTCGGCTTATTGATTCTGGACTTGAAGACCTT
ACTGAATATGTTGTCACACGTTTTTATCGTGCCCCAGAAATCATGCTTTCATCACACATG
TACACCAAATCTGTTGATATTTGGAGCGCTGGGTGTACATTTGCTGAAATCCTTGGCAGA
AAAGTTTTATTCCCAGGGGGGAATTATATCAAGCAAATTGATTTGATTATCAAACTACTA
GGAACTCCAAGTGAAGATGATATGGAATTTATAGCAAATTCTCATGCAAAAAGATTTTTA
CAGTCACTTCCTTATCATCCAAGACAGAATTTAAGGGAGTTTATAGCACCGAATGCATCA
CCTGAAGCTTATGATTTGATGGAAAAAATGCTGGAATTTAATCCTAAAAAGAGGATTACT
GTTGAAGAAGCTTTAAGACATCCTTATTTGGCTGATTTTCATGATTCAGATGATGAACCT
GTGAGTAGTGAAACTGCAGATTTCCAGTTTGAGAACCAGGAGTTTACTTTTGATGAATTG
AAAACATTGTTGCTTGAAGAGTTGGAAATATGCAAAACTTTAGATAATTAG