Identifiers and Description

Gene Model Identifier

SteCoe_36686

Standard Name

None

Aliases

None

Description

IQ domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig11805.0.g273.093350011308561e-50MORN repeat

Tetrahymena ThermophilaTTHERM_005354301.2479464629129513e-47Protein with predicted MORN do
mains localized throughout the
protein and/or associated wit
h other domains having a predi
cted function

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36686(Protein)
MGSKCTTCSYFSRVIEKSNEIYLHEDHTTSSARYVIKETQRPLEVLDYYAKHLKLIKKIQ
ALWRGHQARKSVSLLLKSRISGNRYFTFEESRETLASQLAASLVREERQPYRFLTGAVYV
GQWLGSVRDGQGIQTWPDGARYEGEWRNNKAHGLGKFWHADGDIYEGEWKDDKANGKGIY
RQTNGACYDGEWLDDIQHGFGKETWADGSRYEGYYADGKKHSFGSYYWKDGSKYVGNWKD
NKINGKGTYSWFDGRKYEGEWQDGVMHGFGRYTWKDGRIYEGQYYNDKKHGQGEYMWPDG
KKYKGCWKNGNQHGIGIMIYADGTQKKGEWKDGKRIRWVFD


>SteCoe_36686(CDS)
ATGGGTTCGAAATGCACAACATGCTCATACTTCAGCAGAGTAATAGAAAAATCAAATGAA
ATTTACTTACACGAAGATCACACAACATCTTCAGCCCGTTACGTCATCAAAGAAACCCAG
CGTCCTCTAGAAGTCTTAGACTATTATGCTAAACATTTAAAGTTAATAAAAAAAATTCAA
GCTCTCTGGCGAGGTCATCAAGCTAGAAAATCAGTCTCACTTCTACTGAAATCCCGAATA
TCTGGCAATAGGTACTTTACCTTTGAAGAATCCCGTGAAACTCTTGCATCTCAATTAGCT
GCAAGTCTTGTAAGAGAAGAAAGACAACCGTATCGGTTTTTGACAGGAGCAGTTTATGTT
GGTCAGTGGCTAGGAAGTGTTCGTGATGGTCAGGGAATACAAACTTGGCCTGATGGAGCC
CGTTATGAAGGTGAATGGAGAAATAACAAAGCTCATGGTTTAGGAAAATTCTGGCATGCT
GATGGGGATATTTATGAAGGAGAATGGAAAGATGATAAAGCAAATGGTAAAGGAATTTAT
AGACAAACTAATGGGGCTTGTTATGATGGAGAATGGCTTGATGATATACAGCATGGCTTT
GGAAAAGAAACATGGGCTGATGGTAGTCGATATGAAGGATACTATGCAGATGGAAAAAAA
CATAGCTTTGGAAGCTACTATTGGAAAGATGGATCAAAATATGTGGGAAACTGGAAAGAT
AACAAAATTAATGGGAAAGGAACTTATTCATGGTTTGATGGGAGGAAATATGAAGGAGAA
TGGCAAGATGGAGTTATGCATGGGTTTGGGAGATATACATGGAAAGATGGGAGGATTTAT
GAAGGACAGTATTATAATGATAAAAAGCATGGGCAAGGAGAATATATGTGGCCTGATGGA
AAAAAGTATAAAGGATGCTGGAAAAATGGGAACCAACATGGAATCGGTATTATGATTTAT
GCAGACGGCACACAGAAAAAAGGTGAATGGAAAGATGGCAAACGCATACGATGGGTTTTT
GATTAA