Identifiers and Description

Gene Model Identifier

SteCoe_36724

Standard Name

None

Aliases

None

Description

WD40 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20042.0.g316.054601895401186e-39WD domain, G-beta repeat

Tetrahymena ThermophilaTTHERM_013080104.906094730649281e-35 a conserved centriole and bas
al body protein
WormBaseWBGene000030470.000000000000001713908431542013
Saccharomyces CerevisiaeYBR198C0.0000000000002543665647376923Subunit (90 kDa) of TFIID and
SAGA complexes; involved in RN
A polymerase II transcription
initiation and in chromatin mo
dification

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36724(Protein)
MSNFDPQLLQSFIGHRGTITSIDINAKSIVSASEDSSIQVWHLDSSSRPFRYIGHKGPVY
DVCFSPSGESILSGSRDECIKEWKISVEGKSTTWRAHNGCVRSVGYSTDGRLIISASEDK
SIKLWTSSDHRFQLSLTGHTNSVKSAKFSSDTRMILSTSDDKTLKVWDVPAQTCVQQFTC
DFALNSGRFHPDGTCIAAGTTDGKVKLWDLRSQRIVQVYNSHNDEVLSVDFHPGGDFLSS
GSKDTSVKIWDLRQGHCLYTLLGHQQGVSAIKYNGNGDCFATGSFDSQVMLWKGNTLSKS
LAASKKPVMKNKEDGVNGQKVSEELSGTLSKLVAQLDMVTRAMVMLDQRISNFEEHIARI
TERINAME


>SteCoe_36724(CDS)
ATGTCGAACTTCGACCCGCAACTGCTTCAAAGTTTTATCGGCCACCGTGGGACAATAACA
AGCATAGACATAAACGCCAAAAGTATAGTCTCCGCAAGTGAAGACTCTTCTATTCAAGTC
TGGCATCTAGACTCTTCATCAAGGCCATTTAGATACATAGGCCATAAAGGTCCAGTCTAC
GATGTATGTTTTAGCCCATCAGGTGAATCAATTCTCAGTGGTTCTCGTGATGAGTGTATA
AAAGAATGGAAAATTTCAGTTGAAGGTAAGTCAACAACATGGCGGGCACATAATGGTTGT
GTTCGTAGTGTTGGTTATTCAACTGATGGTAGATTAATAATATCAGCATCAGAAGATAAA
TCAATAAAACTATGGACTTCATCTGATCATAGATTTCAATTATCATTAACAGGTCATACA
AACAGTGTAAAATCTGCTAAGTTCAGTTCAGATACAAGAATGATTCTTTCAACTAGTGAT
GATAAAACTTTAAAAGTTTGGGATGTCCCAGCACAAACCTGTGTTCAGCAGTTTACATGT
GATTTTGCTTTGAATTCAGGAAGATTTCATCCTGATGGAACATGTATAGCAGCAGGGACT
ACTGATGGTAAAGTTAAACTTTGGGATTTAAGATCACAAAGAATAGTGCAAGTGTATAAT
TCACATAATGATGAAGTTTTAAGTGTGGATTTTCATCCTGGAGGAGATTTTTTGTCTTCT
GGGTCTAAAGATACAAGCGTTAAAATATGGGATTTAAGGCAAGGACATTGTTTGTATACT
TTGCTTGGACATCAACAAGGGGTTAGTGCTATTAAGTATAATGGTAATGGAGATTGTTTT
GCTACAGGTAGTTTTGATTCTCAAGTTATGTTATGGAAAGGGAATACTTTAAGCAAATCT
TTAGCTGCTAGTAAAAAACCTGTTATGAAAAATAAAGAAGATGGAGTTAATGGGCAAAAG
GTCTCAGAAGAACTTTCGGGGACGCTTAGTAAACTTGTCGCTCAACTTGATATGGTCACT
AGGGCTATGGTCATGCTTGATCAAAGGATTTCAAATTTTGAAGAGCATATCGCTAGGATT
ACGGAAAGAATTAATGCCATGGAGTAG