Identifiers and Description

Gene Model Identifier

SteCoe_3692

Standard Name

None

Aliases

None

Description

CENP-T_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10148.0.g402.6102790696677047e-23Core histone H2A/H2B/H3/H4

Saccharomyces CerevisiaeYNL030W5.242885663363464e-22Histone H4; core histone prote
in required for chromatin asse
mbly and chromosome function;
one of two identical histone p
roteins (see also HHF1); contr
ibutes to telomeric silencing;
N-terminal domain involved in
maintaining genomic integrity
WormBaseWBGene000018881.4251640827409352e-21
Tetrahymena ThermophilaTTHERM_004981901.0530617357553812e-20Histone H4; one of the four hi
stones (H2A, H2B, H3 and H4) t
hat comprise the protein core
of the eukaryotic nucleosome;
adjacent to HHT2; encoded prot
ein identical to Hhf2p; expres
sed during macronuclear S-phas
e

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_3692(Protein)
MSNKMKADGKVKAKIGKGKGKGLGKVGAKKRHHVIRENIQGITKPAIRRLARRGGVKRLS
GLIYDETRNVLKSFLENVVRDSVTYTEHARRKTVTALDVVYALKRQGRTLYGFGG


>SteCoe_3692(CDS)
ATGTCTAATAAAATGAAAGCTGATGGCAAGGTTAAGGCAAAGATAGGTAAGGGTAAAGGC
AAGGGACTTGGTAAAGTTGGGGCAAAAAAGCGTCACCATGTTATCCGTGAGAACATCCAA
GGCATTACAAAGCCAGCTATAAGAAGACTAGCAAGGCGTGGAGGAGTAAAAAGGCTAAGT
GGTCTAATCTACGATGAGACAAGAAATGTCCTAAAATCCTTCTTAGAAAATGTAGTCCGA
GACTCTGTAACATACACAGAACATGCAAGAAGGAAAACTGTAACAGCTCTTGACGTGGTA
TACGCATTAAAAAGACAAGGAAGGACCCTATACGGCTTTGGTGGTTAA