Identifiers and Description

Gene Model Identifier

SteCoe_36947

Standard Name

None

Aliases

None

Description

AAA_22 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_008650509.602680054508676e-24Largest subunit of the origin
recognition complex
Oxytricha TrifallaxContig20978.0.g1079.602680054508676e-24ATPase family associated with
various cellular activities (A
AA)

WormBaseWBGene000126501.5628821893349888e-18
Saccharomyces CerevisiaeYML065W2.3195228302435696e-16Largest subunit of the origin
recognition complex; involved
in directing DNA replication b
y binding to replication origi
ns; also involved in transcrip
tional silencing; exhibits ATP
ase activity; ORC1 has a paral
og, SIR3, that arose from the
whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36947(Protein)
MVLTRKSSLKRKLTPDHHVPKTSKKPIVAHFNKEELQKMNIDLDKEYKQGKKPHLASRTP
LSRVQHPAPIEKPAKSYKDFIKNYQSREFTWEGSVDIKCTSQGKDLLIYNSVNFQKDTLA
SGDFVELVKEKETCYGQITYLFEENHKKYTECRVFYQERLKHYIETYEYITIPLGYIYKK
VIFTAENGFICETLKDKSGKFIQVNPSYCLERSLFRSKIAMRICANNSSLHKAISLLTLS
SAPSNLVGRTQEKQEILEFLENSIKIGHSANSLYICGMPGTGKTATFLYTIDSLRSREEF
SNSFTFIHVNCMKLSKPQEIYSILCKEICKRKKSGHEALETINHYVKSSKKSGCIVILVD
EIDALLNKKQDVLYNLFNWTNLYNSNFIVSGIANTMDLSDKFIHKVSSRMGNKQIVFAPY
SRDQLQEIITKRLKDTEAFTPDAILFCSAKVASYSGDARRAFQVCKKAAFLALEQKELKI
SIEHIQKAFKQLFASLYVQAIQSLPIPMKLVLATLCLELKNNNKENAQIDRIFYRLNSYC
ETLLLICCFSLKQVAVVINRLASLHLVAVDENCVKLIVSPDDVIDGIKGDEMLAKLEPFL
LGN


>SteCoe_36947(CDS)
ATGGTGTTAACTCGTAAATCAAGTCTAAAGCGAAAGCTTACCCCAGATCATCATGTCCCA
AAAACATCAAAAAAACCTATAGTAGCGCATTTCAATAAAGAAGAGCTGCAGAAAATGAAT
ATCGACCTTGACAAAGAGTACAAACAAGGGAAAAAGCCCCACTTGGCTTCGCGTACACCT
TTATCGCGGGTTCAACACCCTGCACCAATAGAAAAGCCGGCAAAGTCTTATAAGGACTTC
ATCAAAAACTACCAATCCAGAGAGTTTACATGGGAAGGCTCAGTAGATATAAAATGCACA
AGCCAAGGAAAGGACCTTCTTATATACAACAGTGTTAACTTCCAAAAAGATACCCTAGCA
AGTGGGGATTTCGTTGAACTTGTGAAAGAAAAAGAAACTTGCTATGGACAAATAACCTAT
CTTTTCGAAGAAAACCATAAAAAATACACTGAATGCAGAGTTTTCTACCAAGAACGCCTT
AAGCATTATATTGAAACCTATGAATACATCACAATCCCTCTAGGCTACATCTATAAAAAA
GTTATTTTTACAGCGGAAAACGGGTTTATCTGTGAAACCTTAAAGGACAAGTCTGGGAAA
TTTATACAAGTTAACCCCAGTTACTGCCTAGAAAGATCTTTGTTCCGTAGCAAAATTGCC
ATGCGGATCTGCGCCAACAACAGCTCTTTACACAAAGCTATCAGCCTATTAACCCTGTCT
TCAGCTCCATCAAACCTAGTTGGCCGGACCCAAGAAAAGCAGGAAATCCTTGAATTCCTA
GAAAACTCTATAAAAATTGGTCACTCAGCTAACAGTCTTTATATATGTGGCATGCCAGGG
ACAGGCAAAACTGCTACATTTTTATACACAATTGATAGTCTTAGGTCCCGAGAAGAGTTT
TCTAACTCTTTCACATTTATACATGTTAACTGCATGAAGCTATCGAAACCCCAAGAAATC
TACTCGATACTATGCAAAGAGATTTGCAAGAGGAAAAAATCTGGACATGAAGCTCTTGAA
ACAATCAACCATTATGTTAAAAGCTCGAAAAAATCAGGCTGCATCGTTATTTTAGTTGAT
GAAATTGATGCTTTGTTAAATAAGAAACAAGACGTTCTTTATAATCTGTTTAACTGGACA
AATCTATACAATTCAAATTTTATTGTTTCTGGAATTGCTAATACTATGGACCTTTCTGAT
AAATTTATACACAAAGTTAGTAGTAGGATGGGGAATAAGCAAATAGTTTTTGCCCCTTAT
AGTAGAGATCAACTGCAAGAGATCATAACAAAAAGGCTTAAAGATACTGAAGCATTTACT
CCTGATGCTATTCTTTTCTGTTCAGCAAAAGTCGCATCGTATTCTGGAGATGCAAGAAGA
GCGTTCCAAGTATGTAAAAAAGCAGCTTTTTTAGCTTTGGAACAAAAAGAGCTTAAAATA
AGCATTGAACATATACAAAAGGCTTTTAAACAACTTTTCGCATCTTTATATGTCCAAGCT
ATACAGAGTTTGCCTATACCAATGAAACTTGTATTAGCAACATTATGTTTAGAGCTCAAG
AATAATAATAAAGAAAATGCTCAAATTGATAGGATTTTTTATAGACTGAATAGCTATTGT
GAGACTTTGTTGCTTATTTGTTGTTTTTCACTTAAACAAGTGGCTGTTGTAATTAATAGA
CTTGCATCACTTCATCTAGTGGCTGTTGATGAGAATTGTGTTAAGTTGATTGTCAGTCCA
GATGATGTAATTGATGGGATAAAGGGAGATGAGATGCTAGCTAAGCTTGAACCATTTTTA
CTAGGTAATTAA