Identifiers and Description

Gene Model Identifier

SteCoe_36989

Standard Name

None

Aliases

None

Description

CDC45 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12528.0.g861.8048513878454153e-35CDC45-like protein

Tetrahymena ThermophilaTTHERM_005848101.462486227251231e-31DNA replication pre-initiation
complex subunit
Saccharomyces CerevisiaeYLR103C7.781132241133797e-20DNA replication initiation fac
tor; recruited to MCM pre-RC c
omplexes at replication origin
s; promotes release of MCM fro
m Mcm10p, recruits elongation
machinery; binds tightly to ss
DNA, which disrupts interactio
n with the MCM helicase and st
alls it during replication str
ess; mutants in human homolog
may cause velocardiofacial and
DiGeorge syndromes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_36989(Protein)
MKIQLNDLVEVYTQIRQDSLDKSCSLVIFVGGDVDGICACKILTSLLHNDGVQYCIIPVA
NYTELETQLNDLTDPNTHNIIMLNCGGAADFTQLIRDKGLVCYVFDSQRPCLPTNIRSEY
VRVVDETYIEEDLAEESDQDIESGGKRRRERRDPDKKFTTEPDASGVYFGASTAGIIYEL
SRKLNRGTLDMLWLWIVGLTDQLLHNKIDRGEYEAKMNFCVNEVVSNPQNIYRNPTNIQD
TEDDFEIQSGQKPLNSISIEYKDLRIMLYRHWSLYESLYYSNYIASKLGIWKEPGKHRLN
EILAQLGIPLQECKQQYRFMKADYKNTLKEKLSLIGSNYEIDDLFLTTCVRQYSRKRQYC
AADVVYSISALIECPGILEESEHPETISLQDKWLGNFWVAHDALLNDSLLEQGVNLAIEQ
QKAIIQQGTALIDKKAVSPASEFRYAIINSDALTQTKFFHHPLALKKLICFIMEAYQSSR
KNIKPKPMVLCIFNSQRNTYFVCGVISQMQDKNDFGWRFHEAAETVQADFRRDFFEDTYI
EVRKEHFQAFIEQLIAEEI


>SteCoe_36989(CDS)
ATGAAAATCCAACTAAACGACCTAGTAGAAGTATACACACAAATAAGACAAGACTCTCTT
GACAAAAGCTGCTCTTTAGTAATTTTCGTAGGAGGTGACGTCGATGGGATTTGTGCCTGT
AAAATCCTAACATCCTTACTTCACAATGATGGAGTCCAATACTGTATAATCCCAGTTGCG
AATTATACTGAATTAGAAACCCAATTAAATGACCTTACTGATCCTAACACCCACAATATT
ATCATGCTAAACTGTGGAGGTGCAGCTGATTTTACACAATTAATTCGAGACAAAGGTTTA
GTCTGCTATGTTTTTGATAGCCAAAGACCTTGTTTGCCTACAAACATAAGAAGTGAGTAT
GTAAGAGTTGTTGATGAAACTTATATTGAAGAAGACTTAGCTGAAGAAAGCGATCAAGAC
ATTGAATCTGGGGGCAAAAGAAGGCGGGAAAGACGTGATCCTGATAAAAAATTCACTACT
GAACCTGATGCTAGCGGTGTGTATTTCGGAGCATCAACTGCAGGAATAATCTATGAATTA
TCTCGAAAACTCAATCGTGGGACACTTGACATGCTCTGGCTTTGGATAGTTGGCTTAACT
GATCAGCTTCTTCACAACAAAATCGACCGAGGGGAATACGAGGCTAAAATGAATTTTTGC
GTAAATGAAGTGGTTAGCAATCCTCAAAACATATACAGAAACCCAACAAATATTCAAGAT
ACTGAAGATGATTTTGAGATCCAAAGCGGACAAAAACCTTTAAACAGTATATCAATTGAA
TACAAAGATCTAAGAATTATGTTATATAGACATTGGAGTTTATATGAAAGCTTATATTAT
TCTAATTATATAGCATCAAAATTGGGGATATGGAAAGAACCAGGTAAACATCGGCTTAAT
GAAATATTAGCTCAATTAGGTATTCCATTACAAGAATGTAAACAGCAATATCGATTTATG
AAAGCTGATTATAAAAATACTCTAAAGGAAAAACTATCTTTAATAGGTAGTAATTATGAG
ATTGATGATCTTTTTTTAACAACTTGTGTTAGACAATATAGTAGAAAACGTCAATATTGT
GCAGCTGATGTTGTTTATAGTATAAGTGCTTTAATTGAATGTCCTGGTATACTTGAAGAA
AGTGAACATCCTGAGACTATTAGTTTACAAGACAAATGGTTAGGAAATTTTTGGGTCGCT
CATGATGCTTTACTTAATGATTCGTTATTAGAACAAGGGGTTAATTTAGCTATTGAACAA
CAAAAAGCTATAATTCAACAAGGTACTGCGCTTATAGACAAAAAAGCTGTAAGTCCAGCT
AGTGAATTCAGATATGCTATTATAAATAGTGATGCTCTTACTCAAACTAAATTCTTTCAT
CATCCTTTAGCTTTGAAAAAACTCATATGTTTTATTATGGAAGCTTATCAAAGTTCAAGA
AAAAATATAAAACCTAAACCTATGGTCTTGTGTATATTTAATTCTCAAAGAAACACATAT
TTTGTATGTGGGGTTATAAGCCAAATGCAAGATAAAAACGATTTTGGATGGAGATTTCAT
GAAGCAGCAGAGACTGTACAAGCTGATTTCCGTAGAGATTTTTTTGAAGATACGTATATA
GAAGTTAGAAAAGAACATTTTCAAGCATTTATTGAACAGTTGATTGCTGAAGAAATATAG