Identifiers and Description

Gene Model Identifier

SteCoe_37018

Standard Name

None

Aliases

None

Description

Ribosomal_S7e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYOR096W1.5628821893349888e-18Protein component of the small
(40S) ribosomal subunit; inte
racts with Kti11p; deletion ca
uses hypersensitivity to zymoc
in; homologous to mammalian ri
bosomal protein S7, no bacteri
al homolog; RPS7A has a paralo
g, RPS7B, that arose from the
whole genome duplication
Tetrahymena ThermophilaTTHERM_004710903.1391327920480296e-17Homolog of yeast RPS7, human R
PS7;
WormBaseWBGene000044762.3195228302435696e-16
Oxytricha TrifallaxContig980.0.g216.305116760146989e-16Ribosomal protein S7e

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_37018(Protein)
MSDPLAKFHKKDKKPDEFEYHVAQTIGEIEASSPDLKGELKDIIITGASEFEGKHHGATR
QAVIIFFHYRSKNSLKKIHTRLQSELTKRFRKPVVLLLQRTIIPKYFKTKGQQKRPYSRT
LTKVHEAILDDLVYPTSILGKRIRMKSDGRRVFKVLLDPNNRDEVQEKLDVISAVYSKLT
NKEVVFEFPQNRDFPV


>SteCoe_37018(CDS)
ATGTCAGACCCTCTCGCAAAATTCCACAAGAAGGATAAAAAGCCCGATGAGTTTGAATAC
CATGTAGCTCAGACTATAGGGGAAATTGAAGCATCTTCACCTGATCTTAAAGGTGAATTA
AAGGACATTATTATTACAGGAGCCTCAGAGTTCGAAGGCAAACACCATGGAGCAACAAGG
CAAGCTGTGATAATTTTCTTCCATTATAGGTCAAAGAACTCTTTAAAGAAAATTCACACA
AGGTTACAAAGCGAATTGACTAAAAGGTTTAGAAAACCTGTTGTGCTTTTATTACAGAGG
ACAATTATTCCAAAGTATTTTAAGACAAAAGGTCAACAGAAAAGACCTTATTCAAGAACC
TTGACTAAAGTTCATGAAGCGATCTTGGATGATTTGGTGTATCCAACTAGCATACTTGGT
AAGAGAATACGTATGAAATCAGATGGAAGAAGAGTTTTTAAGGTACTTTTGGATCCAAAT
AATAGAGATGAGGTACAGGAGAAACTTGATGTCATCAGTGCAGTCTATAGCAAGCTGACC
AATAAAGAGGTGGTCTTTGAGTTCCCACAGAACAGAGACTTCCCAGTTTAA