Identifiers and Description

Gene Model Identifier

SteCoe_37162

Standard Name

None

Aliases

None

Description

Ribosomal_S17e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYDR447C1.2995814250075031e-24Ribosomal protein 51 (rp51) of
the small (40s) subunit; homo
logous to mammalian ribosomal
protein S17, no bacterial homo
log; RPS17B has a paralog, RPS
17A, that arose from the whole
genome duplication; protein a
bundance increases in response
to DNA replication stress
Tetrahymena ThermophilaTTHERM_007628907.095474162284704e-23Homolog of yeast RPS17, human
RPS17
Oxytricha TrifallaxContig1018.1.g951.9287498479639178e-22Ribosomal S17

WormBaseWBGene000044861.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_37162(Protein)
MGRVRTKTVKRAARAIVEKYYSKMTQDFQSNKRLCDEIAVIQTKRLRNKIAGYATHLMKR
IQKGPVRGISLRLQEEERERKLDYVPETSCVSTRDIKVDAQTMEMVKALDLGEHSNIRVH
EFK


>SteCoe_37162(CDS)
ATGGGACGTGTAAGGACAAAGACTGTCAAGAGAGCAGCAAGAGCTATTGTAGAAAAATAT
TACTCTAAAATGACTCAAGATTTTCAGAGCAACAAAAGGCTTTGTGATGAAATCGCAGTC
ATTCAAACTAAGAGACTTAGAAACAAAATAGCAGGCTATGCTACTCACTTGATGAAAAGA
ATCCAAAAAGGCCCTGTAAGAGGTATTTCTCTTAGATTACAAGAAGAAGAAAGAGAAAGA
AAGTTGGATTATGTTCCTGAAACCTCATGTGTTAGCACACGTGACATTAAGGTTGACGCT
CAAACTATGGAGATGGTTAAAGCTTTGGATCTTGGCGAACATTCTAATATTCGAGTTCAT
GAATTTAAGTAG