Identifiers and Description

Gene Model Identifier

SteCoe_37274

Standard Name

None

Aliases

None

Description

eRF1_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007050402.2273635617957438e-39eRF1 domain 3 family protein
WormBaseWBGene000112804.4737793061811207e-38
Oxytricha TrifallaxContig17990.0.g101.462486227251231e-31eRF1 domain 2

Saccharomyces CerevisiaeYNL001W1.7587922024243116e-25Protein that facilitates ribos
omal subunit dissociation; Dom
34-Hbs1 complex and Rli1p have
roles in dissociating inactiv
e ribosomes to facilitate tran
slation restart, particularly
ribosomes stalled in 3' UTRs;
required for RNA cleavage in n
o-go decay, but reports confli
ct on endonuclease activity; P
elota ortholog; protein abunda
nce increases in response to D
NA replication stress; DOM34 h
as a paralog, YCL001W-B, that
arose from the whole genome du
plication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_37274(Protein)
MRIIGQSIDQTGYGHMTLKMEENDDMWHLYNIISKGDAIKATTLRKVKEESKTGSVVTTK
KKLTLFLKITKIDYEPETPSLRISGVSASENKYMQLGQHHTMDLDLHVSFSIYKRKWDEL
HHERLDMACNPDVTCEVAAIVMEPGLAHVCLITNTSAIVKARVEAHIPRKLKGVSGHDKA
IEKFFEKLVLSITQHLNFDTVKTLLIASPGFTKDQFFEYLKSHKPAWFSQEKVCLAHASS
GEKIALTDTLADPLVKQQLSTAKFTQDMDSIEEFFLVLSKEPNRAVYCLKDVETSARQQA
VQSLFISDSTLRKHKVADREKIIGIIKSVKENGGTVSTLSSIHVAGERLNQLSGIAALLR
FPIYDLQENEEDEAEEDDIEFVEMPEGVGMDNDEEI


>SteCoe_37274(CDS)
ATGAGAATTATAGGTCAAAGCATTGATCAAACGGGCTATGGGCATATGACTCTCAAAATG
GAAGAAAATGACGATATGTGGCATTTATATAACATTATATCAAAGGGAGATGCAATAAAA
GCTACAACTTTGCGTAAAGTTAAAGAAGAATCAAAAACGGGATCTGTCGTCACCACAAAA
AAGAAGCTTACTTTATTTCTAAAAATAACCAAAATTGATTACGAACCAGAGACTCCATCT
CTAAGAATTAGTGGTGTTTCTGCATCAGAGAATAAGTACATGCAACTTGGCCAACATCAT
ACAATGGATTTAGATTTGCATGTGTCCTTTTCGATTTACAAGAGAAAATGGGATGAGCTG
CATCATGAAAGATTAGATATGGCTTGCAATCCTGATGTAACTTGTGAAGTAGCTGCTATA
GTAATGGAGCCTGGACTAGCTCATGTGTGCCTTATTACTAACACTTCAGCTATCGTAAAA
GCTAGAGTTGAAGCTCATATACCTAGAAAGCTTAAAGGGGTATCAGGTCATGATAAGGCT
ATTGAGAAATTCTTTGAAAAATTAGTCCTTTCTATAACTCAACACTTAAATTTCGATACA
GTGAAAACTTTACTTATTGCAAGTCCAGGGTTTACAAAGGATCAATTCTTTGAGTACTTA
AAAAGTCATAAGCCTGCATGGTTTTCACAAGAAAAAGTCTGCCTAGCTCATGCTTCGAGT
GGTGAAAAAATAGCTTTGACAGATACTCTTGCTGATCCTCTAGTTAAGCAGCAATTAAGT
ACCGCTAAATTTACTCAAGATATGGATTCAATTGAAGAATTCTTTTTAGTTTTAAGCAAA
GAACCTAATAGAGCTGTTTATTGTCTTAAAGATGTTGAGACTTCAGCTAGGCAGCAAGCA
GTCCAGTCTTTATTTATTTCTGACTCTACATTGCGCAAGCATAAAGTGGCTGATCGTGAA
AAAATCATTGGGATCATCAAATCAGTAAAAGAAAATGGAGGAACTGTGAGCACATTAAGT
TCAATACATGTAGCTGGAGAAAGACTTAATCAATTATCTGGTATTGCTGCACTATTAAGG
TTTCCAATTTATGATCTTCAAGAAAATGAAGAAGATGAAGCAGAAGAGGATGATATTGAG
TTTGTTGAAATGCCTGAAGGAGTTGGAATGGATAATGATGAAGAAATTTAA