Identifiers and Description

Gene Model Identifier

SteCoe_375

Standard Name

None

Aliases

None

Description

Tubulin domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18792.0.g349.462629465836378e-57Tubulin/FtsZ family, GTPase do
main

Saccharomyces CerevisiaeYML124C3.221340285992516e-27Alpha-tubulin; associates with
beta-tubulin (Tub2p) to form
tubulin dimer, which polymeriz
es to form microtubules; expre
ssed at lower level than Tub1p
; TUB3 has a paralog, TUB1, th
at arose from the whole genome
duplication
WormBaseWBGene000065352.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_375(Protein)
MPRELITIQVGQCGNQVAMRFWDLALQEHARYNKSAIYDEPLSSFFRNVDTRYAEPVDIP
VGKQISNLRARSVVIDMEEGVINNILRSDLGELFDSRQLISDVSGAGNNWAHGHYEYGAK
YHDEIIEKVRYNVEHCDSLQSFFLMHSMGGGTGSGVGTYTLSILADYFPEVFRFSTVVFP
EDDVVTGPYNSVLAMSVLSEFADCVLPVDNQALIGILQMIEESKRKGKSGIKNDLAEPSD
KKEAFAKMNNIIAHMLNNLTCSMRFEGMLNVDLNEITMNLVPFPKMPYLVSSISPLYSIL
DVKMEPRRLDQVFSDVIDKDFQLLKVDPKHSTYLACGLILRGDAKISDIHRNINRIKSDM
NMIHWNQEGYKIGLFGMPYSLLCLSNNSCITTTFANLRQKFMRLYKRKANTHHYTEFMEI
SRFDQALESLDDVMGKYTELNVSKGKASRIKPVI


>SteCoe_375(CDS)
ATGCCTAGAGAACTTATTACAATCCAGGTTGGCCAGTGTGGTAATCAGGTAGCTATGCGA
TTCTGGGATTTAGCATTGCAAGAGCATGCTCGGTACAATAAGTCAGCCATCTATGATGAG
CCACTCTCTAGTTTTTTCAGGAATGTTGATACTCGGTATGCAGAGCCTGTTGACATCCCT
GTGGGCAAACAAATCTCTAATCTTAGGGCACGGTCAGTTGTCATAGATATGGAAGAAGGA
GTAATCAATAATATACTCCGCAGCGATCTTGGGGAACTTTTTGACTCACGTCAACTCATT
TCTGATGTGTCAGGAGCGGGAAATAATTGGGCTCATGGACATTATGAATACGGAGCAAAA
TACCACGACGAGATCATAGAAAAAGTTAGGTACAATGTTGAACACTGTGATTCACTTCAA
AGCTTTTTTCTTATGCACAGCATGGGAGGAGGGACAGGCAGTGGTGTTGGCACATATACA
CTTTCCATACTTGCTGATTATTTTCCAGAAGTATTCAGATTTTCAACAGTTGTATTTCCT
GAAGATGATGTGGTTACTGGACCTTACAACTCTGTACTTGCAATGAGCGTTTTATCTGAA
TTTGCTGATTGCGTGCTTCCTGTTGACAACCAAGCCCTCATTGGCATTCTTCAAATGATA
GAAGAAAGTAAAAGAAAGGGTAAATCAGGGATTAAAAATGACCTGGCTGAGCCGAGTGAT
AAAAAAGAAGCTTTTGCTAAAATGAACAATATAATTGCTCACATGCTTAATAACTTGACC
TGCTCTATGAGGTTTGAAGGCATGCTTAATGTAGATCTTAATGAAATCACCATGAATCTC
GTACCTTTTCCTAAAATGCCTTATCTAGTCTCGAGTATCTCCCCTCTTTACTCAATACTA
GATGTAAAAATGGAACCTCGAAGACTTGATCAAGTTTTTTCTGATGTTATTGACAAAGAC
TTTCAACTTCTCAAGGTAGATCCCAAGCACTCTACATATTTAGCTTGTGGCCTCATTCTC
CGAGGAGATGCAAAAATTTCTGATATTCATAGAAACATAAATCGTATTAAAAGCGATATG
AACATGATCCATTGGAATCAAGAAGGATATAAAATAGGTCTCTTTGGAATGCCTTATTCT
TTGCTTTGTCTTTCTAATAACTCTTGCATAACTACAACTTTTGCTAATCTCAGACAAAAA
TTTATGCGTCTTTACAAGAGAAAAGCTAATACACATCATTATACAGAATTTATGGAGATT
TCCCGTTTTGATCAAGCATTGGAATCACTAGATGATGTTATGGGAAAATATACTGAGCTT
AATGTTTCTAAAGGAAAAGCATCAAGAATTAAACCAGTTATATAA