Identifiers and Description

Gene Model Identifier

SteCoe_37504

Standard Name

None

Aliases

None

Description

EF-hand_6 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22557.0.g472.4426007377405277e-36EF-hand domain pair

Tetrahymena ThermophilaTTHERM_004448703.6251409191435593e-34EF hand family protein. Centri
n family member; EF-hand calci
um-binding protein; also calle
d caltractin; GFP-fusion prote
in localized to specialized st
ructures of oral apparatus, al
ong deep rootlet, and at contr
actile vacuole pore
Saccharomyces CerevisiaeYOR257W0.0000000000006914400106940203Calcium-binding component of t
he spindle pole body (SPB) hal
f-bridge; required for SPB dup
lication in mitosis and meiosi
s II; homolog of mammalian cen
trin; binds multiubiquitinated
proteins and is involved in p
roteasomal protein degradation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_37504(Protein)
MKRGGYEPASRNVASKSKSPSGRRGAEKRGLTEDEIEEIKEAFNLFDTDGSGTIDPKELR
AAMQSLGFESKNPTIYAMIADLDRLGSAIDFDTFLDAITDKLGDKESRSGIEKIFDLFDD
DKTGSINLNNLRRVAKELGETMTVDELNEMLERAASNGHEITREDFYTILTKRAFP


>SteCoe_37504(CDS)
ATGAAACGTGGAGGGTATGAGCCTGCTTCAAGAAATGTAGCCTCAAAGAGCAAATCTCCA
AGTGGAAGGCGTGGAGCTGAGAAGAGAGGTTTGACTGAAGATGAAATTGAAGAAATCAAA
GAGGCATTTAACCTTTTTGACACAGATGGTTCAGGAACAATAGATCCAAAAGAACTACGA
GCAGCAATGCAATCTTTAGGTTTTGAGTCAAAAAACCCAACAATATACGCTATGATTGCA
GATCTTGATAGACTAGGTTCAGCCATTGATTTCGATACATTCTTAGATGCAATAACAGAT
AAACTTGGTGATAAAGAATCACGATCAGGAATCGAAAAAATATTCGATTTGTTTGATGAT
GATAAAACAGGTTCTATCAATTTGAACAACCTTAGGAGGGTTGCTAAAGAGCTTGGCGAA
ACTATGACAGTCGATGAGCTTAATGAAATGCTTGAAAGAGCAGCTTCAAATGGTCATGAA
ATAACAAGAGAAGACTTTTATACGATTTTGACCAAGAGAGCTTTCCCTTAG