Identifiers and Description

Gene Model Identifier

SteCoe_37571

Standard Name

None

Aliases

None

Description

Acetyltransf_10 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002483907.47197233734299e-43Histone acetyltransferase; sim
ilar to GCN5p from Saccharomyc
es cerevisiae; contains bromod
omain
Saccharomyces CerevisiaeYGR252W8.194012623990515e-40Catalytic subunit of ADA and S
AGA histone acetyltransferase
complexes; modifies N-terminal
lysines on histones H2B and H
3; acetylates Rsc4p, a subunit
of the RSC chromatin-remodeli
ng complex, altering replicati
on stress tolerance; relocaliz
es to the cytosol in response
to hypoxia; mutant displays re
duced transcription elongation
in the G-less-based run-on (G
LRO) assay; greater involvemen
t in repression of RNAPII-depe
ndent transcription than in ac
tivation
Oxytricha TrifallaxContig18994.0.g684.4737793061811207e-38Bromodomain

WormBaseWBGene000216365.380186160021138e-32

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_37571(Protein)
MEDDSIEFKVISNDGTPDNLIKLVKLKNIFRKQLPKMPGEYIVRLVLDRKHKSMIASKGN
QIIGGVCFRYFDGQCFSEIAFLAVTYSEQVRGYGTMLMNNLKNYVMKESIRYFLTYADNF
ALGYFKKQGFTTDVDPILPENVWKGYIKDYDGGTLMLCKLDPDIDYTVIHQNIKAQLEFV
KELIDGISPSKICREPPESLKGNNSCEIEEIDGIKQVHYDPSLEISYQDEEKDAKTGCFN
FIIEQMLSDNSSWPFKEPVGPEVAPDYYEIIKDPIDLHTMQDRVNNGYYDSITKFVDDVD
RMFKNCRSYNKKDTVYYKMAEKLEAVIKPFVDQLRESTS


>SteCoe_37571(CDS)
ATGGAGGACGACAGCATCGAGTTCAAAGTTATATCAAACGATGGAACTCCTGACAATCTT
ATTAAGCTGGTCAAACTCAAAAACATCTTTCGTAAGCAGCTGCCAAAGATGCCTGGAGAG
TATATTGTAAGATTAGTCCTTGATAGAAAACACAAAAGCATGATTGCAAGTAAAGGTAAT
CAAATTATTGGAGGGGTATGTTTTAGATACTTTGATGGACAATGCTTTTCAGAAATTGCA
TTTCTGGCGGTAACCTACTCTGAACAAGTTAGAGGATATGGAACTATGCTTATGAATAAT
CTTAAAAACTACGTGATGAAAGAAAGCATTAGATATTTCCTCACTTATGCAGATAATTTT
GCCTTAGGATACTTTAAGAAACAAGGATTTACTACTGATGTTGACCCTATTCTCCCAGAA
AATGTATGGAAAGGGTATATAAAAGATTACGATGGTGGAACTTTAATGTTATGTAAACTT
GATCCAGATATAGACTATACCGTAATACATCAAAACATAAAAGCGCAATTAGAATTCGTT
AAAGAACTAATTGATGGTATTTCTCCAAGCAAAATTTGTAGAGAACCACCTGAATCGCTT
AAAGGTAATAATAGTTGCGAAATTGAAGAAATAGATGGGATTAAACAGGTCCATTATGAT
CCTTCACTTGAAATATCATATCAAGATGAAGAAAAAGATGCAAAAACTGGATGTTTTAAT
TTCATCATCGAGCAGATGCTATCTGATAATTCATCATGGCCTTTCAAAGAACCTGTTGGG
CCAGAAGTAGCTCCAGATTACTATGAAATCATCAAAGATCCTATAGATTTACATACAATG
CAAGACCGTGTTAACAATGGATATTATGATTCAATAACAAAATTTGTTGATGATGTTGAT
CGTATGTTTAAGAATTGCCGAAGCTATAACAAAAAGGATACTGTTTATTATAAAATGGCT
GAAAAACTTGAAGCGGTCATTAAGCCTTTTGTAGATCAATTACGGGAGTCAACTTCATAA