Identifiers and Description

Gene Model Identifier

SteCoe_37993

Standard Name

None

Aliases

None

Description

Ribosomal_S13 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000044872.9374821117108028e-30
Saccharomyces CerevisiaeYML026C2.1705220113036395e-29Protein component of the small
(40S) ribosomal subunit; homo
logous to mammalian ribosomal
protein S18 and bacterial S13;
RPS18B has a paralog, RPS18A,
that arose from the whole gen
ome duplication; protein abund
ance increases in response to
DNA replication stress
Oxytricha TrifallaxContig19625.0.g1041.603810890548638e-28Ribosomal protein S13/S18

Tetrahymena ThermophilaTTHERM_001311103.532628572200807e-24Homolog of yeast RPS18, human
RPS18, bacterial RPS13

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_37993(Protein)
MASLVVTEEKNFNHILRIMNTNIKGKQKVMFALTGIKGIGKRFSNLVLKRAGVDLNKRAG
ELTEDEINQIVTIVQNPVEHQIPEWFLNRQCDVVTGVSSHVAANNLDAKLREDLERMKKM
MLHRGLRHWWGLRVRGQKTKTTGRKGKTVGVSKKK


>SteCoe_37993(CDS)
ATGGCATCCTTAGTAGTCACAGAAGAGAAGAACTTCAATCATATCCTTCGTATTATGAAT
ACCAACATCAAAGGTAAGCAAAAAGTAATGTTTGCTCTAACTGGAATCAAAGGTATTGGG
AAGCGATTCTCAAATCTTGTTCTCAAAAGAGCAGGTGTTGATCTTAACAAACGCGCAGGT
GAATTGACTGAAGATGAAATCAACCAAATAGTTACAATAGTACAAAACCCTGTAGAACAT
CAAATCCCTGAATGGTTTCTTAACAGGCAATGTGATGTTGTCACTGGGGTTAGTAGTCAT
GTAGCAGCGAATAACTTGGACGCTAAATTGCGTGAGGACTTAGAAAGAATGAAAAAAATG
ATGCTACATCGTGGACTTAGGCATTGGTGGGGATTAAGAGTTAGAGGCCAGAAGACCAAG
ACCACAGGAAGGAAAGGCAAGACTGTTGGTGTTAGTAAGAAGAAATAA