Identifiers and Description

Gene Model Identifier

SteCoe_38190

Standard Name

None

Aliases

None

Description

Ribosomal_L37ae domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000044568.533047625744066e-17
Tetrahymena ThermophilaTTHERM_000756702.3195228302435696e-16Homolog of Yeast RPL43, Human
RPL37A
Saccharomyces CerevisiaeYPR043W0.000000000000001713908431542013Ribosomal 60S subunit protein
L43A; null mutation confers a
dominant lethal phenotype; hom
ologous to mammalian ribosomal
protein L37A, no bacterial ho
molog; RPL43A has a paralog, R
PL43B, that arose from the who
le genome duplication
Oxytricha TrifallaxContig19246.0.g310.000000000000012664165549094176Ribosomal L37ae protein family


General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_38190(Protein)
MGKRTKKVGIVGKYATRYGASLRKMVKKIEISQHDTYVCPFCGKQAMKRQSVGIWHCKKC
TKTIAGGAWTPTTPAALAARHNVTRLRKLATSAE


>SteCoe_38190(CDS)
ATGGGGAAACGTACTAAGAAGGTCGGAATTGTAGGGAAATATGCGACAAGGTATGGTGCC
TCACTAAGGAAGATGGTCAAGAAAATTGAAATTTCACAACATGACACTTATGTTTGTCCG
TTCTGTGGAAAACAAGCTATGAAAAGACAATCAGTAGGAATTTGGCATTGTAAGAAATGC
ACTAAAACTATAGCTGGAGGAGCATGGACACCCACAACTCCTGCAGCTTTAGCCGCACGT
CACAATGTTACAAGACTCCGAAAGTTGGCGACTTCAGCTGAGTAG