Identifiers and Description

Gene Model Identifier

SteCoe_38290

Standard Name

None

Aliases

None

Description

Ribul_P_3_epim domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • racemase and epimerase activity, acting on carbohydrates and derivatives (IEA) | GO:0016857

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000172721.9792598779469045e-32
Tetrahymena ThermophilaTTHERM_004927301.462486227251231e-31ribulose-phosphate 3-epimerase
family protein; catalyzes a r
eaction in the non-oxidative p
art of the pentose-phosphate p
athway
Saccharomyces CerevisiaeYJL121C2.1705220113036395e-29D-ribulose-5-phosphate 3-epime
rase; catalyzes a reaction in
the non-oxidative part of the
pentose-phosphate pathway; mut
ants are sensitive to oxidativ
e stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_38290(Protein)
MSISEVIKHMKKYVAPSVLGCDLSNLHSESIDVIQGGCDWLHLDVMDGHFVPNLSFGPPV
IKCLRKHLPSAYFDCHLMVTNPEIWVEPMSQAGASRFTFHIETQSSQESLESLLQSIQSH
NMHTGIAIKPSSEIPLFIDPVVEKGLVDLILVMTVEPGFGGQKFMESTMEKVRSLREKHQ
KLNIEVDGGVNSETVLIADQAGANAFVLGTFVFNSPDRKKTLSDLRKSLNIED


>SteCoe_38290(CDS)
ATGTCTATATCAGAGGTTATAAAACACATGAAAAAGTATGTGGCTCCATCAGTCTTAGGC
TGTGACTTATCCAATCTCCATAGTGAAAGCATAGACGTTATCCAAGGTGGCTGTGACTGG
CTTCATCTAGATGTGATGGATGGTCATTTTGTCCCTAACTTAAGTTTTGGTCCTCCAGTT
ATCAAATGTCTTAGAAAACATTTGCCATCTGCATATTTTGATTGCCATCTAATGGTCACA
AACCCTGAAATCTGGGTTGAACCAATGAGCCAAGCTGGTGCATCACGTTTCACATTCCAT
ATAGAAACTCAGAGTTCCCAAGAATCTCTTGAATCTTTACTTCAATCAATACAGTCTCAC
AACATGCACACGGGTATAGCTATAAAACCTAGTTCAGAAATACCACTTTTTATTGACCCA
GTTGTAGAAAAAGGTCTCGTTGATTTGATTCTTGTAATGACTGTTGAGCCAGGCTTTGGT
GGGCAGAAATTTATGGAAAGTACCATGGAAAAAGTTAGAAGTTTAAGAGAAAAACACCAA
AAGTTAAATATCGAAGTTGATGGAGGAGTGAATAGTGAGACAGTACTTATTGCTGATCAG
GCTGGGGCTAATGCTTTTGTCCTTGGGACATTTGTTTTCAATTCACCTGATAGAAAAAAG
ACCTTAAGCGATTTGAGGAAGTCTTTAAATATAGAAGATTAG