Identifiers and Description

Gene Model Identifier

SteCoe_3854

Standard Name

None

Aliases

None

Description

N6-adenineMlase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12765.0.g651.7587922024243116e-25Probable N6-adenine methyltran
sferase

Tetrahymena ThermophilaTTHERM_007735005.242885663363464e-22Putative N6A DNA methyltransfe
rase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_3854(Protein)
MAQKFFMRYKEKENLNQYWFSENTISALVNEIESLFNEGFIQIACISTPSLYFSLPEQVK
KCAKVFDIDTAFQRDPGFVFFDFNHPENIPDNFFGFFDVVIIDPPFITREVWEKYARAAK
VICKNTGRIILSSIVENAMMLEELLQVRPCLFKPSIPHLVYQYMFYTNYESRGLSVVNPE
IIE


>SteCoe_3854(CDS)
ATGGCTCAAAAGTTCTTTATGAGATACAAAGAAAAGGAAAACCTTAATCAATATTGGTTT
TCTGAAAACACAATCTCAGCCCTAGTCAACGAAATAGAGTCACTTTTTAATGAAGGGTTC
ATTCAAATAGCTTGCATTTCTACCCCAAGTTTATATTTTTCTCTACCAGAACAAGTCAAA
AAGTGCGCCAAAGTTTTTGATATAGACACTGCATTTCAAAGAGACCCAGGCTTTGTTTTC
TTTGATTTCAACCATCCTGAAAACATTCCAGATAACTTTTTTGGGTTTTTTGATGTTGTT
ATTATTGACCCACCTTTTATTACAAGAGAAGTATGGGAAAAATATGCTAGAGCTGCTAAG
GTTATATGTAAGAATACTGGAAGGATTATTTTAAGTTCTATTGTTGAAAATGCGATGATG
CTTGAAGAATTACTCCAGGTTAGACCATGTTTGTTTAAACCTTCTATACCTCATTTAGTA
TATCAGTATATGTTTTATACAAACTATGAATCGAGAGGACTTTCTGTTGTAAATCCAGAA
ATAATTGAATAG