Identifiers and Description

Gene Model Identifier

SteCoe_386

Standard Name

None

Aliases

None

Description

NAD_binding_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006555602.572209372642415e-566-phosphogluconate dehydrogena
se (decarboxylating); catalyze
s an NADPH regenerating reacti
on in the pentose phosphate pa
thway
Oxytricha TrifallaxContig10468.0.g958.408597124803643e-50NAD binding domain of 6-phosph
ogluconate dehydrogenase

WormBaseWBGene000071220.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_386(Protein)
MMKVGWIGTGIMGRSMAEHLIKAGYSLQVYNRTPSKSESLIELGAKFASISEIAQSSDVV
FTMVGYPSDVEEVILSPLGLLQNMKPGSLLIDHTTSSPSLAVRISQEAEKKNVLVLDAPV
SGGDIGAREARLAIMIGGSEEAFNRGLELMKHYGKNIELMGPAGCGQHTKITNQIVIASS
MVGMVEGLSYAVKSGLDAEKVINLLNTGAAANFSLKVYGPRVLRGDLEPGFLVEHFVKDL
GMALEECKRMNLSLPGLAMVNQLYLSLIANGEGRKGTQALIKVIERLNGIKISPNN


>SteCoe_386(CDS)
ATGATGAAAGTTGGATGGATAGGCACAGGAATTATGGGACGGTCCATGGCAGAGCATCTG
ATTAAAGCAGGATATTCTTTGCAAGTATACAATAGAACTCCTTCAAAATCAGAATCTCTA
ATTGAGCTTGGGGCGAAATTTGCATCAATTTCAGAAATCGCTCAGAGTTCTGATGTGGTT
TTCACTATGGTTGGCTATCCTTCTGATGTTGAAGAAGTAATTCTTAGTCCTTTAGGGTTG
CTTCAAAACATGAAGCCAGGATCTTTACTGATTGACCACACAACTTCCAGCCCAAGTCTT
GCTGTGAGAATAAGCCAAGAAGCTGAAAAGAAAAATGTTCTTGTACTTGATGCTCCAGTT
TCTGGTGGAGATATTGGAGCACGAGAGGCTCGTCTTGCTATTATGATAGGTGGTAGTGAA
GAAGCTTTCAACCGAGGTCTAGAACTTATGAAACATTATGGGAAGAACATTGAGCTTATG
GGTCCAGCTGGCTGCGGACAGCATACGAAAATTACAAACCAAATTGTTATTGCTAGTAGT
ATGGTGGGCATGGTTGAGGGTTTGTCTTATGCTGTAAAATCAGGCTTAGATGCTGAAAAA
GTTATTAATTTATTAAACACTGGGGCAGCTGCAAACTTTTCATTAAAGGTTTACGGGCCT
AGGGTGTTAAGAGGAGATCTTGAGCCGGGCTTCTTGGTAGAGCATTTTGTCAAAGATTTA
GGAATGGCTTTAGAAGAATGTAAAAGGATGAACTTGTCTTTGCCAGGACTTGCCATGGTT
AATCAATTATATCTATCACTGATTGCAAATGGAGAAGGCCGAAAAGGAACTCAAGCACTT
ATTAAAGTCATTGAAAGACTAAACGGAATCAAAATTTCTCCTAATAATTAA