Identifiers and Description

Gene Model Identifier

SteCoe_3903

Standard Name

None

Aliases

None

Description

SF1-HH domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig8621.0.g103.532628572200807e-24KH domain

Tetrahymena ThermophilaTTHERM_004445703.873997628687187e-21Zinc knuckle family protein
WormBaseWBGene000138087.781132241133797e-20
Saccharomyces CerevisiaeYLR116W4.248354255291589e-18Component of commitment comple
x; which defines first step in
splicing pathway; essential p
rotein that interacts with Mud
2p and Prp40p, forming a bridg
e between the intron ends; als
o involved in nuclear retentio
n of pre-mRNA; relocalizes to
the cytosol in response to hyp
oxia

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_3903(Protein)
MRTEDSLALVETVVPRKRTRWEEGDAYRVNRREIDIRKEKYSSSRWSVDRSFFPPPLTYI
PDFLNPDQVELILRQFRIEDISRRLTANDLEIQDFEVRSPSPEPIYDPKTGQRMNTREVR
AREKLQKERNTCIEECLRIDPLYKAPADYKPPTATRKLYIPQYGEAPPQSYVSLILGPRG
KTQKILEKKTKCKIYIRGRGASRGKNYQFENEDEPMHVLITAESEVDIERCCEILEPILN
GKLDDEDNQKRRFELMRIGAENRIGITYNSDWCEVCGEQGHKKYGCPNRTLALGWSCEIC
SDKNHSTQDCPNRKIKKKTLEEQLEEFNRETGAGVQLTHYDQMVIKSYKVHQKNTKKKDN
KEIKDPVGEEELLPPGVDY


>SteCoe_3903(CDS)
ATGAGAACTGAAGATAGTCTTGCTTTAGTAGAAACTGTTGTACCAAGGAAGAGAACAAGA
TGGGAAGAAGGTGATGCCTATAGAGTAAACAGAAGGGAAATTGATATAAGAAAGGAAAAA
TACAGTTCGTCCCGTTGGAGTGTTGATAGATCATTTTTCCCTCCTCCCTTGACTTATATT
CCTGATTTTCTTAACCCTGACCAAGTAGAGCTTATTCTTCGTCAGTTTAGAATTGAAGAT
ATATCTCGAAGACTTACAGCTAATGACCTTGAAATACAAGATTTTGAAGTTAGATCACCA
TCACCTGAACCTATCTATGACCCAAAAACTGGACAAAGAATGAATACTAGAGAAGTAAGA
GCTAGAGAAAAACTTCAAAAAGAAAGAAACACATGTATAGAAGAATGTTTAAGAATTGAC
CCACTTTATAAAGCTCCAGCTGATTATAAACCACCAACAGCAACAAGAAAACTTTATATA
CCTCAATATGGAGAAGCTCCACCACAAAGTTATGTTTCACTTATCCTTGGACCCAGAGGT
AAAACACAGAAAATTCTTGAGAAAAAAACAAAATGCAAAATTTATATAAGAGGACGAGGA
GCATCAAGAGGAAAAAATTATCAGTTTGAAAATGAAGATGAACCTATGCATGTGTTAATT
ACAGCTGAATCAGAAGTTGATATTGAAAGATGTTGTGAAATCTTAGAACCTATTTTAAAT
GGAAAATTAGATGATGAAGACAATCAGAAAAGGAGATTTGAACTTATGCGTATAGGAGCA
GAAAATCGTATAGGAATCACTTATAATTCAGATTGGTGTGAAGTTTGTGGAGAACAAGGA
CATAAAAAGTATGGTTGTCCTAATCGTACTCTTGCACTTGGATGGTCATGTGAAATATGT
AGTGATAAAAATCATTCTACTCAAGATTGTCCTAATAGAAAAATTAAGAAAAAAACTCTG
GAAGAACAATTGGAAGAGTTTAATAGGGAAACTGGAGCAGGAGTTCAATTGACTCATTAT
GATCAGATGGTAATAAAATCTTATAAAGTTCATCAAAAAAATACTAAGAAAAAAGATAAT
AAAGAAATCAAAGATCCAGTTGGGGAAGAAGAATTACTTCCACCAGGCGTAGATTATTAA