Identifiers and Description

Gene Model Identifier

SteCoe_39347

Standard Name

None

Aliases

None

Description

Ribosomal_L19e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004445103.975449735908647e-31Homolog of Yeast RPL19, Human
RPL19; Ribosomal protein L19e
containing protein
WormBaseWBGene000044315.900090541597061e-29
Oxytricha TrifallaxContig22564.0.g708.75651076269652e-27Ribosomal protein L19e

Saccharomyces CerevisiaeYBR084C-A2.3802664086944007e-26Ribosomal 60S subunit protein
L19A; rpl19a and rpl19b single
null mutations result in slow
growth, while the double null
mutation is lethal; homologou
s to mammalian ribosomal prote
in L19, no bacterial homolog;
RPL19A has a paralog, RPL19B,
that arose from the whole geno
me duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_39347(Protein)
MVTLRLQKRLAASVLKCGKRRVWMDPNEVQEISLANSRQNVRKLVKDGFIVKTPQAIHSR
SRARLHKESVQKGRHTGMGKRKGTREARMPEKILWMRRQRVLRRLLRKYRASKKIDKTLY
HDFYVGSKGNMYKNKTVLSDAIFKAKANAEREKNLKDQQEARRQKKTKV


>SteCoe_39347(CDS)
ATGGTGACTTTGCGGTTGCAAAAGCGTCTCGCTGCAAGTGTTCTAAAATGCGGCAAAAGG
CGAGTCTGGATGGATCCAAATGAAGTCCAAGAAATCTCCTTAGCCAACTCTCGCCAAAAC
GTAAGGAAACTAGTTAAAGATGGGTTTATCGTAAAAACTCCTCAAGCAATTCATTCACGT
TCAAGAGCAAGACTTCATAAAGAATCAGTACAAAAGGGAAGACATACAGGAATGGGTAAA
AGAAAAGGTACACGTGAAGCGAGAATGCCTGAAAAAATCTTATGGATGAGAAGACAAAGA
GTATTAAGAAGATTGTTAAGGAAATATAGAGCTTCAAAGAAAATTGATAAAACTTTATAT
CATGATTTCTATGTTGGGTCAAAAGGAAATATGTATAAGAATAAGACTGTGCTTAGTGAT
GCTATATTCAAAGCTAAAGCTAATGCTGAGAGAGAAAAGAATTTGAAGGATCAACAAGAA
GCTAGAAGACAGAAGAAAACCAAGGTTTAG