Identifiers and Description

Gene Model Identifier

SteCoe_4080

Standard Name

None

Aliases

None

Description

IQ domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18292.0.g1083.720075976020836e-44Myosin head (motor domain)

Tetrahymena ThermophilaTTHERM_000464701.2160992992528256e-37Myosin heavy chain; member of
proposed myosin Class XX, dist
inct from previously defined m
yosin classes; contains predic
ted coiled-coil domain and IQ
motifs predicted to bind a cal
modulin family protein

WormBaseWBGene000216850.000000005602796437537268

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_4080(Protein)
MSEKKIKAAIIIQKYFRDYLCRKAMSRKLNSSLPTGHLTQMATKIQKWFKGEIVRKKILR
IREAATKIQSFYRMKKAQSSYITIMIAVLRIQSAIRSYSIRSKAVKSRLDEFLSMESALL
KNLGTLEQAELFTSVLGSTESPVEEALKTLSTIAEGTASLSQSQLISTGSLAIQSKQVSP
FHIEKMYFFTRPLDFELIADDSIVYDPLWSKQFEALNKDLISKEEHIMDVSIGNCHTLAV
TSKGRLFAWGWNDKAQCGSKGTRPRLVEGLRDQRIIQITCGDDHSLILNHSGQVYGFGDN
TKGQLGQGSYKELSNVVSIELPPCKQVVAVGTQNMCVTANNELYLWPFETVHGEKRSYPM
KMLSDYQVQEVSVGYNFAMILATSGIVFSLGCNNSNGQLGHGDAIPRSSPTMILSFKKQG
EKIASVCCGYRHVIARSTLGKLYTWGNGSDGQLGTGIYEHEYTPKVLILKNDRNKPIQVT
AGYRNTCIMMENRKILVAGSISQIKTPVFIEANVQNKLPEFFRNQGEFAVVKVQSVWSRL
IACILITIVDLRYMKSFQNAQSKMNNVLNTIATKWTSKSIEPPFIESVAGFYPANLCKKI
VNKTVMRQSKTLKNPFDDMKDKIGEILKKPNDKWTIEEKYMMEHISKYNQ


>SteCoe_4080(CDS)
ATGAGCGAAAAAAAAATCAAAGCAGCAATTATAATCCAAAAATACTTCCGTGATTACCTA
TGCCGTAAAGCAATGTCACGCAAACTAAACTCATCTCTTCCTACAGGCCACTTAACCCAA
ATGGCAACAAAGATTCAAAAATGGTTCAAAGGAGAAATCGTTAGGAAAAAAATCCTCAGA
ATCCGTGAGGCTGCGACAAAAATCCAAAGTTTCTATAGGATGAAAAAAGCGCAAAGTTCT
TATATTACTATCATGATAGCAGTACTCAGAATCCAATCAGCGATAAGATCATATAGCATT
AGGTCTAAAGCTGTGAAAAGTCGTCTAGATGAGTTTTTATCGATGGAATCAGCGTTACTT
AAAAATCTTGGGACTCTAGAACAAGCTGAACTATTTACTAGTGTGCTTGGTTCAACAGAG
TCTCCTGTTGAAGAAGCATTAAAAACTCTTTCTACGATTGCTGAAGGAACAGCATCATTG
TCACAAAGTCAGCTTATAAGTACAGGAAGTCTTGCAATCCAATCAAAACAAGTCTCTCCA
TTCCACATCGAAAAAATGTACTTTTTCACAAGACCTTTAGACTTTGAGCTAATAGCAGAT
GACTCAATAGTCTACGACCCATTATGGAGTAAGCAATTCGAAGCTCTAAACAAAGATCTA
ATTTCAAAAGAAGAGCACATTATGGATGTGTCAATCGGTAACTGCCATACACTTGCTGTA
ACAAGCAAAGGCCGACTTTTTGCCTGGGGTTGGAACGACAAAGCTCAATGCGGAAGTAAA
GGAACAAGACCTCGTTTAGTAGAAGGTTTAAGAGACCAGCGAATAATTCAAATAACTTGT
GGTGATGACCATAGCCTAATCCTTAACCATAGTGGTCAAGTTTATGGTTTTGGTGACAAC
ACAAAAGGTCAGCTTGGTCAAGGAAGTTACAAAGAGCTTTCAAATGTTGTATCAATAGAA
CTACCTCCATGTAAACAAGTAGTTGCCGTAGGTACTCAAAATATGTGTGTTACAGCAAAT
AACGAACTTTACTTATGGCCTTTCGAAACAGTTCATGGTGAAAAACGTAGTTACCCAATG
AAAATGCTCTCCGACTATCAAGTTCAAGAAGTATCAGTTGGTTACAATTTCGCTATGATT
TTAGCAACATCAGGTATTGTATTTTCATTAGGTTGCAATAATAGTAATGGACAACTTGGC
CATGGAGACGCAATTCCAAGAAGTTCACCCACTATGATCCTTTCATTTAAAAAACAAGGT
GAAAAAATTGCTAGTGTTTGTTGTGGATATCGACATGTTATAGCTAGATCTACATTAGGA
AAACTTTATACTTGGGGTAATGGTAGTGATGGACAACTTGGTACTGGAATTTATGAACAT
GAATATACACCTAAAGTTCTAATATTAAAAAATGATCGGAATAAACCTATACAAGTTACA
GCAGGGTATAGAAATACATGTATTATGATGGAAAATAGGAAAATTCTTGTTGCTGGAAGT
ATTAGTCAAATAAAAACTCCAGTATTTATTGAAGCTAATGTTCAGAATAAACTACCTGAG
TTTTTTAGAAATCAAGGCGAATTTGCTGTAGTTAAAGTTCAATCCGTATGGAGTAGGCTT
ATTGCTTGTATTCTTATTACTATTGTGGATTTAAGATATATGAAAAGTTTTCAAAATGCT
CAAAGTAAAATGAATAATGTTTTAAATACTATTGCTACGAAATGGACTAGTAAAAGTATT
GAACCTCCGTTTATTGAAAGTGTTGCTGGGTTTTATCCAGCGAATCTTTGTAAGAAAATT
GTGAATAAAACTGTTATGAGACAGAGTAAAACTTTAAAAAATCCGTTTGATGATATGAAA
GATAAGATAGGCGAGATTTTGAAAAAACCTAATGACAAGTGGACAATTGAAGAGAAGTAT
ATGATGGAGCATATTTCTAAATATAATCAGTAA