Identifiers and Description

Gene Model Identifier

SteCoe_40903

Standard Name

None

Aliases

None

Description

GSHPx domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig15624.0.g561.0530617357553812e-20Glutathione peroxidase

WormBaseWBGene000091651.0530617357553812e-20
Tetrahymena ThermophilaTTHERM_008956605.74952226429356e-19Glutathione peroxidase family
protein
Saccharomyces CerevisiaeYBR244W3.1391327920480296e-17Phospholipid hydroperoxide glu
tathione peroxidase; protects
cells from phospholipid hydrop
eroxides and nonphospholipid p
eroxides during oxidative stre
ss; induced by glucose starvat
ion; protein abundance increas
es in response to DNA replicat
ion stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_40903(Protein)
MGGAKASCANSFTSIYDIVVKAIGGGSVSMSEYRGKVLLIVNVASEUGLTKKNYTQLVEI
EKEYASKGLEILAFPCNQFLHQEPGSDEEIEKFARNYGANFRVFSKTKVNGKEACDLYKF
LRLNSNLDGGKIGWNFGKFIVSRDGSKIEYYGPRTDPSDLVQHFKKYL


>SteCoe_40903(CDS)
ATGGGTGGTGCAAAAGCAAGCTGTGCCAACTCCTTTACCTCCATTTACGATATTGTTGTA
AAGGCAATAGGTGGAGGCTCTGTCTCAATGTCAGAGTATAGGGGTAAGGTGCTACTGATA
GTTAACGTGGCCTCAGAGTGAGGTCTTACCAAAAAGAATTACACTCAACTGGTCGAAATT
GAAAAGGAATATGCTTCAAAAGGATTAGAAATATTAGCTTTCCCGTGTAACCAGTTCTTA
CACCAAGAACCGGGCTCAGATGAAGAAATCGAAAAGTTTGCTAGAAATTATGGAGCCAAT
TTCCGTGTGTTTTCGAAGACTAAAGTCAATGGCAAAGAAGCATGCGACTTGTACAAATTC
CTTAGATTAAACAGCAACTTGGACGGAGGAAAAATTGGATGGAACTTCGGAAAATTTATA
GTAAGCCGTGATGGAAGCAAGATTGAGTATTATGGACCAAGAACTGATCCGAGCGATCTA
GTTCAGCACTTCAAGAAATATTTGTAA