Identifiers and Description

Gene Model Identifier

SteCoe_4111

Standard Name

None

Aliases

None

Description

kinase related to Ciliate-E2a subfamily

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000777206.639677199580735e-36Protein kinase domain containi
ng protein. Sequence similarit
y to a protein kinase family u
nique to Tetrahymena thermophi
la (Eisen et al., 2006)."
Oxytricha TrifallaxContig9444.0.g881.3336148155022614e-34Protein kinase domain

WormBaseWBGene000005531.2995814250075031e-24
Saccharomyces CerevisiaeYFR014C7.095474162284704e-23Calmodulin-dependent protein k
inase; may play a role in stre
ss response, many Ca++/calmodu
lin dependent phosphorylation
substrates demonstrated in vit
ro, amino acid sequence simila
r to mammalian Cam Kinase II;
CMK1 has a paralog, CMK2, that
arose from the whole genome d
uplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_4111(Protein)
MSLFESFDCEVNNALSFWGDLESYTLSDILENKLYSSQVKIQKSSGDWKSRSLILTTTCL
YYCGNDMNPKKKAIVKWKKVEAFQEQSGSDERFGFKIGHETIYKEFYLENTDLLEDWLNE
LSKVVIMSDFEDEFAVIKEVGKGNYANVYLVKELATSNQFAVKAISKEIVYKSSRGVAAV
INEIEIMKKLSHPSLLKLHKVYENTENVFIIVDYVEGGDLFRRILKKGKFTEASAAKFMK
TMLQGLHYLHSQKIVHRDLKPENLLMISQDNDEDFKIGDFGLACICTESQTLRCGSPGYI
APEILSKKPYSFKADIFSAGVILYILLSGRAPFYGKTSNEILIKNQECRIYFHEKDWNDI
SNDSIDLVLKLTDPDPDIRLTAEEALQHKWIISMHNEPGKKLQLPSIGKIAFESPEQGFS
CSLMQRLNEKRNLGIQIIYGTVDNEESKNENATRNIKATGILKKLREDELK


>SteCoe_4111(CDS)
ATGTCGCTTTTCGAGTCTTTCGATTGTGAGGTAAACAACGCTTTATCTTTCTGGGGAGAT
TTAGAATCTTATACTCTATCCGATATATTAGAAAACAAGCTTTATTCCTCACAAGTGAAA
ATCCAAAAGTCTTCAGGAGACTGGAAATCCCGTAGTCTAATCCTCACAACTACCTGCCTT
TATTATTGTGGTAATGACATGAATCCTAAAAAAAAAGCAATTGTTAAATGGAAAAAAGTT
GAAGCTTTTCAAGAACAAAGTGGTTCAGATGAGAGGTTTGGGTTTAAAATTGGACATGAG
ACTATATATAAAGAGTTTTATTTAGAAAACACTGATTTATTAGAAGATTGGCTTAATGAA
CTTAGTAAAGTTGTGATTATGAGTGATTTTGAAGATGAGTTTGCTGTTATTAAAGAAGTT
GGTAAAGGGAATTATGCGAATGTTTATTTGGTTAAAGAATTGGCTACATCGAATCAATTT
GCGGTTAAAGCTATTAGTAAGGAAATTGTGTATAAGAGCTCAAGAGGGGTTGCTGCGGTG
ATTAATGAGATTGAGATTATGAAAAAATTGTCCCATCCTTCGTTGTTAAAGTTGCATAAA
GTGTATGAAAATACTGAGAATGTGTTTATTATTGTGGATTATGTGGAAGGAGGAGATTTG
TTTAGGAGGATTTTGAAGAAGGGAAAGTTTACGGAAGCCTCTGCAGCAAAATTCATGAAA
ACCATGCTCCAAGGCCTTCACTATTTGCACTCTCAAAAAATAGTCCACCGTGACCTCAAG
CCAGAAAACCTTCTAATGATTTCCCAAGACAACGACGAAGACTTCAAAATCGGGGACTTT
GGCTTAGCTTGTATTTGCACTGAAAGTCAAACTTTACGTTGTGGGTCTCCAGGTTACATA
GCCCCAGAAATCTTATCAAAAAAGCCATATAGTTTCAAAGCCGATATTTTCAGCGCAGGG
GTCATTCTCTATATCCTCCTTTCAGGTCGGGCACCTTTTTATGGTAAAACATCAAATGAA
ATCCTTATAAAAAATCAAGAATGCCGAATATATTTTCATGAAAAAGACTGGAATGATATA
TCAAACGATAGCATTGATCTTGTTTTAAAACTTACAGACCCAGATCCTGATATTAGGCTT
ACAGCAGAAGAAGCTTTACAACATAAATGGATTATTTCTATGCATAATGAACCTGGGAAA
AAACTTCAATTACCTTCTATTGGAAAAATAGCTTTTGAATCACCTGAACAAGGGTTTTCA
TGTTCGCTAATGCAAAGACTTAATGAAAAAAGAAATCTAGGTATTCAGATTATATATGGG
ACTGTTGATAATGAGGAAAGCAAAAATGAGAATGCAACAAGGAATATTAAAGCTACTGGT
ATATTAAAAAAATTAAGAGAAGATGAGCTTAAGTAA