Identifiers and Description

Gene Model Identifier

SteCoe_4292

Standard Name

None

Aliases

None

Description

Actin domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003104702.572209372642415e-56Actin-related protein

Oxytricha TrifallaxContig18261.0.g523.817497188671175e-54Actin

Saccharomyces CerevisiaeYDL029W2.820770088460135e-53Essential component of the Arp
2/3 complex; Arp2/3 is a highl
y conserved actin nucleation c
enter required for the motilit
y and integrity of actin patch
es; involved in endocytosis an
d membrane growth and polarity
; required for efficient Golgi
-to-ER trafficking in COPI mut
ants
WormBaseWBGene000002004.1863939993042314e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_4292(Protein)
MEDPLICDNGTGFIKVGRATSNFPEYSVPSIIGKPHPNFAELIDRTIDMNAEYIGEEIES
KRAALQLLRPMDEGIVKDWDAMEKVWAYTFNKFKVDRSKTCVMMTEAPMNPLKNREKMAE
IMYEKLGFIGLDVQIQATLSLYAMGYVTGLVIDSGDGVTHCIPVAEGRVNTHSIQRINIA
GRHLTEYLIKLLLLRGYNFHTSADFEIVREIKERMCYVSADILEERTLAKDTTVLEEDYQ
LPDGSWIKVGPERFECGEVLFSPYLLGKDCDGLSEMIFNSIMNSPMDVRASLFRGMLLSG
GTTMLPGISTRIQRDLRRMHRELRGGSSSSKIVIKVEDPPYRKHLVYIGATTLTRIYKAS
PESWTYKFNWEEEGPRILHKNR


>SteCoe_4292(CDS)
ATGGAGGATCCGCTTATTTGTGATAACGGGACTGGTTTTATAAAAGTTGGCAGGGCAACT
TCGAATTTCCCGGAATACTCAGTCCCATCAATAATTGGTAAACCCCACCCTAACTTTGCA
GAATTAATTGATAGGACAATAGATATGAATGCAGAGTATATTGGAGAAGAAATAGAATCA
AAACGAGCTGCTTTACAACTATTACGGCCAATGGATGAAGGTATTGTTAAGGATTGGGAT
GCAATGGAAAAAGTATGGGCTTATACCTTTAACAAATTCAAAGTAGACAGAAGTAAGACT
TGTGTTATGATGACTGAAGCTCCAATGAACCCATTGAAAAACCGTGAGAAGATGGCAGAA
ATCATGTATGAAAAGCTTGGCTTTATTGGTTTAGATGTGCAAATTCAAGCAACTCTATCT
TTATATGCAATGGGTTATGTTACAGGCTTAGTCATCGATTCAGGTGATGGAGTCACTCAT
TGTATACCAGTAGCTGAAGGTAGAGTCAATACTCATTCAATCCAAAGAATAAATATAGCT
GGTCGTCATTTAACTGAATACCTAATCAAATTGCTTCTTTTACGTGGGTACAATTTCCAC
ACTTCAGCTGATTTCGAAATAGTTCGCGAAATTAAAGAAAGAATGTGTTATGTTTCAGCA
GATATTCTTGAAGAAAGAACTTTAGCTAAAGATACAACAGTTCTAGAAGAAGACTATCAA
TTACCAGATGGGTCTTGGATAAAAGTTGGCCCGGAAAGGTTTGAATGTGGAGAAGTACTT
TTTAGTCCTTATTTGCTAGGAAAGGATTGTGATGGGTTGTCAGAGATGATTTTCAATAGT
ATTATGAATTCACCTATGGATGTTAGAGCTTCGTTGTTTAGAGGTATGCTATTATCTGGT
GGGACGACAATGCTTCCTGGGATTTCTACTAGGATTCAAAGAGACCTTAGGAGAATGCAT
AGAGAATTAAGAGGTGGAAGCTCTAGTAGTAAGATTGTTATTAAGGTAGAAGATCCTCCT
TATAGAAAGCATCTTGTTTATATTGGAGCAACAACTTTGACAAGGATTTATAAAGCAAGC
CCTGAGTCGTGGACTTACAAATTTAATTGGGAAGAAGAAGGACCGAGAATTCTCCATAAA
AATAGATAA